Words Containing: A,C,I,Y
(In Any Order)
There are 6,179 words,
4,531 phrases and
0 abbr's with
A,C,I,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
crazily | 7 | 21 | adverbadv | |||||
adverb • in an insane manner | ||||||||
oxyacid | 7 | 20 | noun, adjectiven, adj | |||||
noun • any acid that contains oxygen | ||||||||
wackily | 7 | 19 | adverb, adjectiveadv, adj | |||||
adverb • in a mildly insane manner | ||||||||
tackify | 7 | 19 | verbv | |||||
Valid word for Scrabble US
| ||||||||
hayrick | 7 | 19 | nounn | |||||
noun • a stack of hay | ||||||||
panicky | 7 | 18 | adjectiveadj | |||||
adjective satellite • thrown into a state of intense fear or desperation | ||||||||
sickbay | 7 | 18 | noun, adjectiven, adj | |||||
noun • (nautical) a room for the treatment of the sick or injured (as on a ship) | ||||||||
fancify | 7 | 18 | verbv | |||||
verb • make more beautiful | ||||||||
privacy | 7 | 17 | nounn | |||||
noun • the quality of being secluded from the presence or view of others • the condition of being concealed or hidden | ||||||||
calcify | 7 | 17 | verbv | |||||
verb • become impregnated with calcium salts • become inflexible and unchanging • turn into lime; become calcified • convert into lime | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (101)
typicalcharityprivacycynthiacynicaldynamicclarifyclaritycyanideinfancylyricalcrazilyacrylicpanickyacidityscarifycypriansickbaytacitlypaucityprimacypicardyscythiascarilycalcifysaucilydacoityopacitywackilydiarchypiscaryciliarypliancyvacuityacetify
...View all with 7 letters...
Phrases (4)
acid dyesick payinky capcity manWords (244)
carryingphysicalactivityfacilitycapacityintimacymysticalsociallydelicacycalamitychastitymythicaldynamicsculinaryactivelysanctityatrocityaudacitychivalrycelibacyclassifyliteracyscarcitycrayfishatypicaltenacityefficacylocalitysynapticmiscarrycyclicalraciallyamicablycandidlysacristy
...View all with 8 letters...
Phrases (15)
pay claimmagic eyechip awayclay pipecabin boydairy cowbasic dyefair copynaha citycity hall
...View all with 8 letters...
Words (440)
certainlybasicallyspeciallyspecialtycertaintyphysicianmachinerytypicallysyndicatecaptivitymagicallyhierarchydiplomacylogicallyradicallymedicallyhydraulicpiggybackmusicallycandidacyactualitychlamydiaethicallyjudiciarycordiallyobstinacyoligarchychantillyparalyticcruciallyancillarycynicallyayurvediccausalitychrysalis
...View all with 9 letters...
Phrases (27)
by machinelike crazycosmic rayin any casecivil yearmint candycubic yardmason cityrice paddygray birch
...View all with 9 letters...
Words (661)
especiallyofficiallyphysicallyconspiracyhystericaldictionarycreativitygymnasticstragicallyironicallyspecialitycapabilitypsychiatrysystematichydraulicsclinicallyverticallycriticallychemicallygraciouslyincendiarysurgicallydelicatelybricklayercreativelycautiouslypiccadillycosmicallypyromaniaccommissarycriminallymaniacallylegitimacysyndicatedanalytical
...View all with 10 letters...
Phrases (63)
kuwait cityrailway carcanary birdchalcid flycrazy quiltcall it a daypaying backoil companyglycine maxglyptic art
...View all with 10 letters...
Words (845)
practicallynecessarilytechnicallypsychiatricpoliticallysympatheticgeneticallyfinanciallyaccordinglyuncertaintycontinuallycalligraphybeneficiaryreactionarysymmetricaldrasticallypunctualityaristocracyclairvoyantmasculinitytchaikovskycataclysmicapocalyptichyperactiveincessantlydiscrepancyfranticallyvicariouslymetaphysicsaerodynamiciconographypyroclasticprincipallycrystallineorganically
...View all with 11 letters...
Phrases (119)
laying claimspecial jurydry cleaningvictoria dayacrylic acidbicycle racebicycle seatafrican greypolicy makervena cystica
...View all with 11 letters...
Words (931)
particularlypsychiatristspecificallyaccidentallyoccasionallychristianityincreasinglyincidentallydramaticallydisciplinarysatisfactoryhypocriticalaccompanyingmunicipalityconsiderablymiraculouslyencyclopediahypotheticalhistoricallyeconomicallyauthenticitymetaphysicalunofficiallyromanticallymythologicalartificiallypsychopathichystericallybiologicallyperiodicallytechnicalitycommerciallynymphomaniacpatheticallyaerodynamics
...View all with 12 letters...
Phrases (178)
visual acuityscantily cladathletic typechristmas dayacrylic fiberacrylic paintascension dayacrylic resincost analysisbaby carriage
...View all with 12 letters...
Words (949)
psychologicalautomaticallyunnecessarilytheoreticallyexceptionallysignificantlystatisticallydysfunctionalcontradictorycomplimentaryradioactivityfantasticallyphysiologicalpsychosomaticgynaecologistrealisticallyprecautionarycompatibilitystrategicallyhypochondriaccategoricallyparadoxicallycomparativelymagnificentlysarcasticallystereotypicalideologicallysuperficiallyunequivocallydiscretionaryhyperactivityfunctionalityunsympatheticaestheticallyencyclopaedia
...View all with 13 letters...
Phrases (221)
harvey cushingaleatory musicdirect antonymfamily picidaecardiac rhythmfamily poaceaeuranyl radicalcooley's anemiaacrylate resincost of quality
...View all with 13 letters...
Words (765)
scientificallyhypotheticallycinematographypsychoanalysissystematicallyintellectuallycoincidentallymetaphoricallyaffectionatelyelectronicallyaccountabilitydemocraticallymathematicallyrespectabilitygeographicallyalphabeticallycardiomyopathyastrophysicistunsatisfactoryconfidentiallypathologicallythermodynamicsexcruciatinglyconservativelypsychoanalyticdiscriminatoryconventionallypredictabilitygynaecologicalsatisfactorilylinguisticallymetaphysicallytelepathicallysociologicallyscholastically
...View all with 14 letters...
Phrases (332)
family apiaceaethoracic cavityorder mysidaceasabbatical yearcapital of italycapital of kenyacapital of libyapolymeric amidecarya laciniosacooley's anaemia
...View all with 14 letters...
Words (582)
psychologicallyconfidentialityunconditionallypsychotherapisttechnologicallysynchronizationphysiologicallyphilosophicallychronologicallysympathomimeticsynergisticallyinaccessibilityincompatibilitycrystallizationintellectualityparentheticallymicroscopicallyaerodynamicallycardiopulmonarytherapeuticallysynchronisationcontroversiallycytomegaloviruscompassionatelyuncomplimentaryrecrystallizinglackadaisicallydramaturgicallyunacceptabilitycommunicabilitylogarithmicallygastronomicallyhypochondriacalseismologicallygynandromorphic
...View all with 15 letters...
Phrases (395)
auditory ossiclestay of executiondialysis machineannunciation dayfamily lemnaceaeadvisory servicefamily arecaceaejohn quincy adamsgenus bombycillahyoscyamus niger
...View all with 15 letters...
Words (262)
enthusiasticallyindiscriminatelyconstitutionallycatastrophicallyunpredictabilitypsychoanalyticalphylogeneticallyjournalisticallycircumstantiallypharmaceuticallymonosyllabicallyunapologeticallythermostaticallysurrealisticallypsychobiologicalthrombocytopeniaphotographicallyinconceivabilityparapsychologistconversationallyneuropsychiatricdiscriminatorilyparadigmaticallypornographicallycolorimetricallyjurisdictionallythermometricallyantistrophicallyparamagneticallyradiographicallycommensurabilitymicrogametophytepolyphyleticallypolyrhythmicallythermoplasticity
...View all with 16 letters...
Phrases (414)
tympanic membranestrictly speakingfamily cyperaceaechristian huygensfamily cyprinidaecapital of hungarywilliam wycherleycardiac glycosidecygnus buccinatorchemical analysis
...View all with 16 letters...
Words (168)
unconventionalitybacteriologicallyconstitutionalityanthropologicallyparathyroidectomymaterialisticallycardiorespiratoryelectrostaticallythermodynamicallyincommunicabilityinconsequentiallyphilanthropicallysocioeconomicallypsychotherapeuticmultidisciplinaryprobabilisticallyinterdisciplinaryhyperreactivitiesself-contradictoryradiobiologicallyisoelectronicallyphysiotherapeuticcercidiphyllaceaeunexchangeabilitykaleidoscopicallyradioisotopicallyparapsychologistsparasitologicallyspectroscopicallymonochromaticallyrationalisticallythrombocytopeniashypochondriacallychlortetracyclinemonosyllabicities
...View all with 17 letters...
Phrases (452)
mary leontyne pricesalvia leucophyllabalaena mysticetusczech monetary unitlycopodium alpinumhypoglycemic agentcuban monetary unitlycopus americanussubphylum craniatatheological system
...View all with 17 letters...
Words (79)
characteristicallyinconsequentialityhypercoagulabilitypsychopathologicalinterchangeabilitysociopsychologicalneuropsychologicalpolyesterificationspectroheliographymultifunctionalitypsychotherapeuticspathophysiologicalanthropocentricitycylindrical-stemmedlipopolysaccharidepostpsychoanalyticunconstitutionallystereospecificallyimmunocytochemicalcalymmatobacteriumstoichiometricallyautobiographicallyrecrystallizationsmucopolysaccharidehypercholesteremiamagnetostrictivelyphenomenologicallyophthalmologicallysubmicroscopicallygeochronologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatesglycosaminoglycansorthopsychiatrists
...View all with 18 letters...
Phrases (434)
bombycilla cedrorunbombycilla garruluseriobotrya japonicalachrymal secretiondivision cynodontiafreudian psychologycolumbia universityclass schizomycetesread-only memory chipfamily trichechidae
...View all with 18 letters...
Words (63)
hydrochlorothiazidepsychophysiologicalcinematographicallypolyesterificationsextralinguisticallyparathyroidectomiesparthenogeneticallycrosslinguisticallynonrelativisticallymucopolysaccharideslipopolysaccharidesunconstitutionalitycytodifferentiationconceptualisticallycytopathogenicitiesindividualisticallybacteriochlorophyllmagnetohydrodynamicpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallydehydrochlorinatingdehydrochlorinationphosphatidylcholinemercury-contaminatedchromoblastomycosiselectromagneticallycontradistinctivelyelectromechanicallyinterferometricallycross-linguisticallyimpressionisticallyelectrophoreticallyanthropocentrically
...View all with 19 letters...
Phrases (393)
acetylsalicylic acidfamily cyclopteridaescandinavian countryfamily cynoglossidaehydrastis canadensisalpine type of glaciergiles lytton stracheyphytolacca americanafamily dasyproctidaedivision schizophyta
...View all with 19 letters...
Words (38)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolparathyroidectomizedcrystallographicallyhyperadrenocorticismcytodifferentiationsimmunocytochemicallymagnetofluiddynamicsbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyphotoautotrophicallymagnetohydrodynamicshistoincompatibilityultramicroscopicallyelectrophysiologicalmicrocrystallinitiesroentgenographicallyencephalomyocarditischemotherapeuticallyhydrochlorothiazidespsychopathologicallypsychopharmacologiesmicrophotometricallypsychopharmacologistsyncategorematicallyhypercoagulabilities
...View all with 20 letters...
Phrases (349)
yellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaeorder myxobacterialesfamily trachipteridaeoryctolagus cuniculusmarchantia polymorphadivision tracheophytabalance sheet analysis
...View all with 20 letters...
Words (14)
psychopharmacologicalstereomicroscopicallymucopolysaccharidosisacetylcholinesteraseselectromyographicallydendrochronologicallyphotolithographicallyantiferromagneticallyhypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (244)
icelandic monetary unitigor ivanovich sikorskyhelichrysum bracteatumdesoxyribonucleic acidextrauterine pregnancybyzantine architectureeucalyptus fraxinoidescynoglossum officinalecapital of pennsylvaniaginglymostoma cirratum
...View all with 21 letters...
Words (4)
spectrophotometricallyotorhinolaryngologicalelectrophysiologicallyencephalomyocarditisesPhrases (210)
haliaeetus leucorhyphustrazodone hydrochloridefamily dendrocolaptidaeloyalist volunteer forcesubfamily bassariscidaerhythm and blues musicianmale reproductive systemnicaraguan monetary unitbrachycome iberidifoliafamily branchiostomidae
...View all with 22 letters...
Words (4)
laryngotracheobronchitiselectrocardiographicallymicroelectrophoreticallyschizosaccharomycetaceaePhrases (118)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotamary wollstonecraft godwinprivately held corporationprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisapocynum androsaemifoliumantiarrhythmic medication
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (88)
igor fyodorovich stravinskyfrancis scott key fitzgeraldsymphoricarpos orbiculatuscentral intelligence agencypolystichum acrostichoidescaulophyllum thalictroidespyotr alexeyevich kropotkinandrei arsenevich tarkovskyconstant of proportionalitylepidocybium flavobrunneum
...View all with 25 letters...
Phrases (68)
brassica oleracea gongylodeshunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthsubdivision basidiomycotina
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (49)
american revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinco-operative republic of guyanacommissioned military officernuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joyce
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (43)
aleksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevskydepartment of homeland security
...View all with 28 letters...
Phrases (28)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeehydrangea macrophylla hortensisultrasonic pulse velocity tester
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (25)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalitybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (17)
digital communications technology2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agency
...View all with 31 letters...
Phrases (18)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateuniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (16)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economy
...View all with 33 letters...
Phrases (8)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (8)
angiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (12)
severe combined immunodeficiency diseaseuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausenus army criminal investigation laboratory
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay