Words Containing: A,A,E,G,Y
(In Any Order)
There are 572 words,
1,390 phrases and
0 abbr's with
A,A,E,G,Y in.
Best Scoring Words With: A,A,E,G,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| quayage | 7 | 20 | nounn | |||||
noun • a fee charged for the use of a wharf or quay | ||||||||
| getaway | 7 | 14 | nounn | |||||
noun • the attribute of being capable of rapid acceleration • a rapid escape (as by criminals) | ||||||||
| gateway | 7 | 14 | noun, adjectiven, adj | |||||
noun • an entrance that can be closed by a gate | ||||||||
| haylage | 7 | 14 | nounn | |||||
noun • Grass (often cut longer than for silage) partially dried and ensiled to exclude air, or plastic-wrapped in large bales. | ||||||||
| yardage | 7 | 12 | nounn | |||||
noun • distance measured in the aggregate number of yards | ||||||||
| drayage | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (28)
giveawaysavagelysavagerypaygradepygmaeangetawaysgatewaysquayagesgynaeceagynaeciagramaryegarganeyamygdalelayeragegarbageyhaylagesyardagesmangabeycabbageydrayagesargyreialegatarylancegaypaysageshypogaeagameplaymetayagegageablyPhrases (7)
gray areagive awaygrey areaaway gamegray sageeagle rayad agencyWords (35)
graveyardpageantryhydrangeaaveragelylaryngealhypallageagreeablygraybeardpaygradesamygdalesgiveawayskerygmatamangabeysgrayscalegraywackegraywaternaugahydegramaryesamygdalaelayeragesguayaberagarganeysgainsayermamaguyedlancegayslygaeidaegaugeablyslate-grayhypogaealhypogaeanglycaemiaaerophagyasynergiagameplaysmetayagesPhrases (8)
mealy sagegreat yearparty gamegray aldergray skategray whaleclary sagepearl grayWords (48)
passagewaypharyngealgraywackeshydrangeasagitatedlygraybeardsgraywatersacromegalynaugahydeschangeablymanageablyhypallageslaryngealsguayaberasmetagalaxygraveyardsraygrassesshaggymanegainsayersaegypiidaesexagenarycalystegiaapterygialyaffingaleaerographypanegyricaamygdalineareographyamygdalateglycaemiashypalgesiasteatopygagallabiyehvoyageablegray-haired
...View all with 10 letters...
Phrases (19)
genus khayagray marketgray matterpoyang lakegenus caryaeating awayyagi aerialgrey jackalvena azygosyi language
...View all with 10 letters...
Words (64)
daydreamingarchaeologyangelicallypythagoreancarriagewayhaematologyfragmentaryhyperphagiasteeragewaypanegyricalreanalyzinglallygaggedaggregatelypassagewayskaryogamiesappealinglypaleographyagamospermyshaggymaneselegiacallyballyraggedsteatopygiagameticallycausewayingacetylatinghexagonallyptyalagoguelegationaryenglaciallyevangeliarymegacephalyanemographygynaecomastreanalysingappeasingly
...View all with 11 letters...
Phrases (41)
laying wasteplaying areaoryx gazellaplayoff gameafrican greyparaguay teavarying haregravity wavesan diego baymelange yarn
...View all with 11 letters...
Words (69)
oceanographymagneticallycardiomegalynauseatinglyextravagancyagreeabilityhepatomegalycarriagewaysmanageriallydisagreeablybathypelagicunmanageablygynecomastiaagranulocyteexaggeratoryhyperphagiasrampageouslysteatopygiasunchangeablywallydraiglefragmentallypentagonallytangentiallyirrefragablysteeragewaystetragonallyextralegallypolygalaceaeptyalagoguesargyrotaeniapolygonaceaegeodynamicaldodecagyniangrassy-leafedgrassy-leaved
...View all with 12 letters...
Phrases (57)
mary magdalenbaby carriagegenus tayassugrand larcenyfrighten awaygalveston baygenus eucaryalatency stageguitar playersafety margin
...View all with 12 letters...
Words (91)
strategicallycategoricallyoveranalyzingextravagantlypalaeontologymagisteriallygeostationaryallegoricallyindefatigablymanageabilitypedagogicallyenigmaticallylethargicallychangeabilityarteriographyantigenicallyegomaniacallybacteriophagyalgebraicallyoropharyngealfragmentarilyunappealinglyimaginativelyrectangularlyagranulocytescarpetbaggeryevangelicallymetallographygraphemicallymegakaryocytedamageabilitygynecomastiaspanegyricallyabiogenicallydevastatingly
...View all with 13 letters...
Phrases (83)
vaginal arteryyakut languagecedar mahoganyradiant energygenus martyniagenus nymphaearussian agencyfederal agencyuygur languagetarget company
...View all with 13 letters...
Words (73)
cinematographygeographicallycharacterologygynaecologicalembarrassinglypaleopathologyadvantageouslygenerationallygreatheartedlyupgradeabilitygenealogicallyacceleratinglyantiregulatorysalvageabilityexasperatinglyexhilaratinglybreathtakinglypaleogeographyadrenergicallyearthshakinglymegakaryocyticphlegmaticallyepigraphicallyglutaraldehydeapologeticallyiatrogenicallyhypomagnesemiamegakaryocytesmegascopicallyrectangularitydiageneticallynasopharyngeallegalisticallypaleomammalogycoelanaglyphic
...View all with 14 letters...
Phrases (103)
tubal pregnancypharaoh of egyptvolleyball gamedrainage systemtattletale greymargin of safetygenus chrysaorapac-man strategyyoruba languagevotyak language
...View all with 14 letters...
Words (59)
anaesthesiologyencephalographydemographicallyheartbreakinglypalaeopathologyunchangeabilitymegagametophytemarriageabilityhypercoagulablegravimetricallytelegraphicallyagranulocytosesmetallurgicallyunimaginativelygeomagneticallydecarboxylatingglutaraldehydescyanoethylatingphytoflagellatexeroradiographyideographicallyhypomagnesemiasxerographicallyparageneticallyradiotelegraphyexchangeabilityintransigeantlyinterchangeablyirrefragabilityargumentativelymineralogicallydisagreeabilityhymenogastralesrhyparographersrhyparographies
...View all with 15 letters...
Phrases (120)
asamiya languagewystan hugh audenfamily triglidaegenus cyanocittaarachis hypogaeamask of pregnancyegg-laying mammalgeneral assemblyassembly programgenus dasyprocta
...View all with 15 letters...
Words (37)
unapologeticallyparamagneticallyparapsychologiesglossopharyngealarchaeologicallyrechromatographystenographicallyflabbergastinglyflexographicallyindefatigabilityprotoarchaeologylymphangiectasialymphangiectasispetrographicallybathythermographgeneralizabilitybiodegradabilityechocardiographyorganolepticallysyncategorematicmegagametophytesmegalomaniacallypalaeodendrologypalaeornithologyacanthopterygiangranulocytopeniaepigrammaticallyethnographicallyphytoflagellatesevangelisticallyeschatologicallycladogeneticallycrystallographerpaedogeneticallypaleographically
...View all with 16 letters...
Phrases (117)
italian greyhoundcardiac glycosidecommercial agencyautogenic therapyexemplary damagesyeoman of the guardcalystegia sepiumpharyngeal tonsilgrand canyon stategrand mal epilepsy
...View all with 16 letters...
Words (26)
bacteriologicallyunexchangeabilitymammothermographyferrimagneticallylexicographicallylaryngopharyngealcrystallographerscrystallographiesoceanographicallybathythermographszoogeographicallysamoyedic-speakingglossopharyngealsneuropharmacologydisadvantageouslymetapsychologicalpalaeoclimatologypalaeoethnographychoreographicallydialectologicallyphytogeographicalhaemoglobinopathypyrometallurgicalpaleoanthropologypaleomagneticallythermographicallyPhrases (122)
dame margot fonteyninterstate highwaypearly everlastingcoccygeal vertebragenus symphalangusmalaysian languageyeniseian languagecrataegus monogynagenus haematoxylongenus haematoxylum
...View all with 17 letters...
Words (9)
hypercoagulabilityinterchangeabilitylymphangiographiesspectrographicallyultracentrifugallymetallographicallypalaeoanthropologycryptogrammataceaehydrometallurgicalPhrases (143)
genus styracosaurusafghan monetary unitnavigational systemfamily asparagaceaeantipsychotic agentfamily polygalaceaegenus chamaecytisusfamily magnoliaceaecrataegus oxycanthaarthur garfield hays
...View all with 18 letters...
Words (11)
cinematographicallyextralinguisticallyparthenogeneticallymagnetohydrodynamicechoencephalographyelectromagneticallyhysterosalpingogramcharacterologicallyphytogeographicallypaleogeographicallyelectrocardiographyPhrases (107)
family cynoglossidaealpine type of glacieravogadro's hypothesissalicylate poisoninghydrobates pelagicuscrataegus oxyacanthaghanian monetary unitsolidarity surchargefamily zingiberaceaegenus arctostaphylos
...View all with 19 letters...
Words (8)
lymphogranulomatosesmagnetofluiddynamicsmagnetohydrodynamicsroentgenographicallypsychopharmacologiessyncategorematicallyhypercoagulabilitiesplethysmographicallyPhrases (91)
clyde william tombaughbyelorussian languageclassifying adjectiveluscinia megarhynchosfamily gasterosteidaeunabridged dictionarylaw enforcement agencyglycerol tripalmitateegyptian monetary unitfamily gleicheniaceae
...View all with 20 letters...
Words (3)
hypogammaglobulinemiaelectromyographicallyantiferromagneticallyPhrases (66)
bulgarian monetary unithungarian monetary unitextrauterine pregnancynorwegian monetary unitcucurbita argyrospermastrawberry haemangiomasoren aabye kierkegaardsamuel taylor coleridgeagricultural chemistryfamily myrmecophagidae
...View all with 21 letters...
Words (1)
electroencephalographyPhrases (57)
guatemalan monetary unitnicaraguan monetary unitparaguayan monetary unithenry engelhard steinwaysamuel pierpoint langleybahasa malaysia languageharvery williams cushingmary ludwig hays mccauleybarbados-gooseberry vinevertebrate paleontology
...View all with 22 letters...
Words (2)
laryngotracheobronchitiselectrocardiographicallyPhrases (42)
argyroxiphium sandwicensemary wollstonecraft godwinsir terence mervyn rattigantechnology administrationfederal republic of germanyandrei andreyevich gromykopaul johann ludwig von heyseposterior meningeal arteryelectromagnetic delay lineaccessory hemiazygous vein
...View all with 24 letters...
Phrases (20)
diamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencybeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating systemarab revolutionary brigadespodkamennaya tunguska riverdevelopmentally challengedsuperorder acanthopterygii
...View all with 25 letters...
Phrases (22)
brassica oleracea gongylodeshunting and gathering societyevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsystem of weights and measuresentandrophragma cylindricumbenign prostatic hyperplasiamyrtillocactus geometrizanscalifornia single-leaf pinyon
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (21)
george percy aldridge graingeraleksandr sergeyevich pushkinco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycecryptobranchus alleganiensistaras grigoryevich shevchenkotopical prostaglandin eyedropmikhail sergeyevich gorbachev
...View all with 27 letters...
Phrases (13)
great smoky mountains national parkdigital communications technologydiego rodriguez de silva y velazquezport-access coronary bypass surgeryprimary subtractive color for lightrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityovulation method of family planning
...View all with 31 letters...
Phrases (11)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnonsteroidal anti-inflammatory drugprimary subtractive colour for lightoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkofederal emergency management agencyattorney general of the united statesbosnian-herzegovinian monetary unit
...View all with 32 letters...
Phrases (9)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencypositron emission tomography scannerphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay
