Dictionary Only:
Profanity Off:

9-Letter Words Containing: T,A,L,E

 (In Any Order)
There are 2,825 9 letter words, 334 9 letter phrases and 0 9 letter abbr's with T,A,L,E in.

Best Scoring 9 Letter Words With: T,A,L,E

Expand?WordSave?LengthUsagePointsType
outdazzle9
28 verbv
Valid word for Scrabble US
quetzales9
27 nounn
Valid word for Scrabble US
catalyzed9
24 verbv
verb

• change by catalysis or cause to catalyze

jacksmelt9
24 nounn
noun

• a relatively large silversides of the Pacific coast of North America (known to reach 18 inches in length)

cataplexy9
23 nounn
noun

• An abrupt loss of muscle tone, sometimes associated with narcolepsy.

catalyzer9
23 nounn
noun

• That which catalyzes.

• A catalytic converter.

equitably9
23 adverb, adjectiveadv, adj
adverb

• in an equitable manner

catalyzes9
23 verbv
verb

• change by catalysis or cause to catalyze

excitably9
23 adverb, adjectiveadv, adj
Valid word for Scrabble US
metaxylem9
23 nounn
Valid word for Scrabble US
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 9 Letter Words

Words (2825)
beautifulcertainlygentlemanchocolatecelebrateemotionalelizabethpotentialliterallysatellitetravelingcharlotterelationstechnicalessentialvalentineslaughterestablisheliminatetranslatematerialsvegetablespecialtyrealisticidenticalstrangelycalculateclassmatetravelledheartlesselaborateinstalledhumiliatestrangledwaterfallconstablecathedralsexualityartillerybaltimoreprivatelyliberatedconsulatetolerancepalestinespectaclealternateafterlifealignmentcataloguementalitycelestialreluctantcleopatrahairstyleeternallytalkativeperpetualstimulateunhealthyduplicatefairytaletelegraphancestralhealthierlucrativepatientlyeditorialselectmanbraceletstravellermutilatedobligatedwastelandstairwellplacementspeculatehelveticacultivatestabilizeskepticalimplantedvigilanteplanetaryheartfelttimetableunrelatedoutlanderplasteredpopulatedlancasterdismantleretaliatecirculateguatemalaafflictedtastelessflattenedunethicalescalatorirritableentangledstranglerregulatedalienatednewcastlestainlessaristotlealchemistcoastlineelevationtelepathyrelocatedreplicateheadlightelementalalleviateinfantiledauntlessversatileimplicatesimulatedlettermandeadliestliquidateathleticselectoralcartilagetreadmillscepticalescalatedevaluatedleviathanmenstrualsocialitesolitaireregulatorveritablesaltwaterannulmentformulateallocatedelongatedfraternalgenitalialoathsomeretrievalwhitehalladaptablefaithlesslethargicquarterlylafayetteadultererdetailingliberatormetabolicallotmentstalematehabitableheartlandinsulatedbacterialreputableelegantlyluftwaffeethicallybetrothaltolerablecattlemanpoplitealleastwisereptilianearnestlyprevalentearthlingwaistlinedebatablestranglesturntablerectanglealabastermasterfulsaltpeterthanklesspalatableexcitablelaceratedherbalistwealthierbeanstalkstonewallstraplesslamentingrelegatedfalteringtraceableectoplasmbilateralaffiliategladstonehereticalventilatevalidatedequitablesteelheadflagstonemaelstromdialecticreticularcartwheelshavetailtearfullystipulatesleaziesttabboulehephialteslaminatedtolerablydecathlonunearthlyappellantnameplateanecdotallubricateculminatehealthilyflattereruntenableplaintivepetechialrationalegalantineautoclavepulsatilepatrolledcataplexystoppablecentrallyplastiquestreamletimmutableforestallmatchlessweatherlycorrelatesublimatecassouletvertebralstabiliseisraelitefaultlesspentothalgalvestonlevitatedrepellantflatulentstatelessmelatonincabrioletdelegatedacetylenedelftwareloculatedangulatedtailgatedcelebrantgnarliestsaltpetreeffectualreinflatecannulatecountableelevatingcatalepsydesolatedsectionalcarmelitebedlamitedefiantlyappellatealertnessfluctuatealtimeterhealthfulmentalisttrustableblanketedresultantinterplaydeflatingrelatableglutamateafterglowvestigialpollinatelaterallylegislateinoculatecalibratedeflationacclimategauleitercaliphateplasterercoagulateflatbreadtablewaredeathblowinelegantpentanglepeculatedhailstonecockatieldeclarantsacculatelassitudeptolemaicundatablepalpitateactualizestableboybobtailedwealthilyreinstallmeltwaterdislocatecatalyzerwaterlineamplitudeapplecartgallstonemedallistlambastedelucidatefloodgateevaluatorhorsetailpetulanceunalteredstragglerpocatellodeathlessleastwaysdonatellobrutalizeclassiesttabulatedearthlikeinitialedimmolatedoscillateunlatchedcopulatedemulatingalbuterolluxuriateallentownretailingtracklessmalachiteteachableinterlacethinkablepostulatetrailheadestimablemodulatednonlethalpainterlyuntamableuntangledlatecomerplatitudetoolmakerembattledsellotapepercolatedeathlikedelineatetouchablebasketfulexculpateinexactlyligaturedsaleratusflashiestlevantinedefoliantdefoliatefulminatestainablepastoralestellatedveritablyrecatalogstalenessneutrallyelastomeradoptableritualizemetalloidclammiestcatalogerundulatedthermallytrehalosemolybdateausterelylitigatedtelophasetrochlearancientlytrabeculauneatablelarcenistsublethalartlesslystablemananticlinesultanateanaleptictractablereplatingclarionetflageoletspatulatementalismwhitetailglaciatedbrutaliseinculcatefaceplatecumulatedfightablelakefrontwaterfowlcantabiledoorplatewaterlesstantalizealeutiansinviolatesteamrolltrainablehalothaneequitablybagatellecastellaninstallersubalternlethalitygenialityantenataltitillateemulationunrealitytinplateddevaluategallaudetfootplatecatalyzedwhaleboatrefutableteakettleexplicatepixilatedcanticlesexfoliatetailgateraerialistmetalheadcatchableteasinglyplacentaltularemiametalworkghastliercalmativetensionaltramlinestentacledsulfonateeightballdefaulterallegiantgeneticalprintableallergistsaltinesspatrollerloadstoneulceratedplanetoidtetralogyvacillatebelatedlychelationalimentalannulatedcapsulatepanetellalaciniatevellicateeristicalitalicizeparacletetasselledlangoustecogitableastraddlegraticuleinterlardtantalisepustulategetatablecockateelcolligatecollimateasceticalslantwiseprelaturealtercatevictualervitalizerheritableplacativelineamentassaulterclathratepeculatorlineationtailplanealmanditemetallizeheadstallacidulateacidulentutterableestradiolcandlenutolfactiveepilationtreillagepullulatetelluriancentricalsteerableleafstalkdefalcatetablelandirrealitypollenatealveolateaetiologysaintlikecurtilagemelioratealleviantblastemalaculeatedvulcanitetrackableworktablebisulcateanalgetictrilobatelatimeriabookplatesemestralwelfaristdepilatordecollateleatheredfaveolateacetylatebalustersignitableimputablebranchletavertablecaterwaulavertibleteetotalsfabulatedfabulatesgatefoldsleafleterplaymatesphlyctenaintervalemaltreatsverticalsballastedmaltstersmetallingplacentaegiftablesautolyzessinuatelymutilatesrefloatedwaistlessevaluatesunadeptlyangulatesloyaltiesinterclanlithiaseslegationsplicatureoutlastedflabbiestelutriateinsulatesstylobatepinnulatebractlesstantalatefaceclothfortaliceparticlescoelomataliberatesacropetalexpellantcatalyseslapidatesavirulenthemelytrarealteredmuscatelsteasellerarbalestselastasesregelatescorollateamativelylatenciescolocatedlanceletsultrapurecatalyzessplatterspetiolatearbelestsslatheredrevaluateoutwalkedbastillesstairlikeallometryultrararefoveolaterelocatesairliftedlateraledtoleratedwabbliesttabulatesarcuatelypalletizeblatheredapiculatepastillesgestaltenreclinatecucullateepithelialakeportsmelaniticcorelatesmatchableteazelledstraddleddivulgatelavishestflatlinerobstacleslaterborncreatabletelamonesflatlineschapletedpopulatesscrutablepantaletsfestivalspleatlessbootlacesnucleatestreatablepalliatedpalliatesultrasafepulsativekhalifateexaltedlyflatmatesclatteredtailleursafflicterdialysatesaltboxesalterableurceolatelateriteslateritictraileredaustralesqualitiesloathnessadultlikeballotersqualmiestsemimetaladultnessprattlerseggplantsbluecoatsdextrallyaciculatelaterizesstraggledtollgatesaxletreespolestarsantiglarelapstrakestragglestriangledalphabetsdecretalstrianglesflatteredemptiabletraillesssimulatescurtaileddialyzateaffluentspantalonecurtailertelecastslunulatedfilamentsvictualedlevantingtelicallycattlemenallocatesidealistsdilatableelephantsantiquelycollaretsultrawidelatheringdebatablydetailersgenitallyanimatelyelectabletropaeolaperinatalfoliolateabilitiesplaintextquantilestridentallambastestaintlesselevatedsareolatedmaterielspaintablefloreatedpantofflealimenteddoubtablealterantspantoflespatchabletracelessentanglesexultancetelefaxesungulatesfloriatedmetalwarebetrayalslevigatedpedestalsaeroliticuitlanderpanelistsoutgleamsundulatesflauntiertomalleysmountableemulativeoversaltsplanchetspearliesttramelledreputablylabellatefatalnesssealiftedlevitatesenterablelitigablerelaxantserectabledesolatesgleamiestcisternalpearlitictimescalelobulatedtrammelerlandsleitcoeternalsporulatedesolatorgallantedasphaltedoutdazzleablativespsaltriescoevalitystorablesuntanglesabsolventclimatizeclaystonedesaltingnearliestforestialallosteryvisitablefacultiescatecholsambulatedambulatesclankiestbaseplateviolaterswheatlessaltimetryneoplastyloveseatsmodulatesobligatesautotelicunlatchescadentiallocalitesrelegatesroyaltieslamenterstasteablenontalkertramplersaltitudesauditableacetabulaallotteesagilitiescelibaticchatelaintubulatessemitonalallotypesplatinizelocatableshiftabletactilelyoutsailedpetulancygratulatereimplantlustratedtremulantvalidatessalientlyfeudalistplankterslocativesenucleatedenotableafterclapantefixalspottabletriplanesaperturalwatchableantelopesultimatessultanessfalsitiesbaldpatedcenturialenactablepreallotsmislocatetangiblesfalterersprolatelyantennuletrauchledtrauchlesfidelistacellmatesspoliatedpentacleslaudativespoliatesmisrelatebrocatelspraelectsleachatesalgometryoutplacesexfoliantmilitatedunplaitedrevictualmilitatesoutplayedvitaliseddepilatedbasipetalpenaltiesplethorasvitalisesknittabledepilatesthallusesenthrallsrequitalsmediatelyescalateshazelnutsquartilesconflatedteacherlyplantletsatemporalconflatesnathelessidolaterstentaclesjaculatessalivateddetonableplayactedsalivatesloricatedexcitablyvitalizedrebuttalsreplantedcultratedteleplaystradeabletravailedpailletteimplanterplantsmenvitalizesretotaledkalifatesethmoidalreflatingreplastercalvitieschelatingargilliteejectablejubilatedrotatabletravelersbloviatesjubilatesvibratilemaculatedstageablecablecastkaliphatepamphletsrefutablyequatablehelpmatesplaydateslivetrapsdelegatesdovetailsfrailtieshalftimestalkinessclaritiesbestowalslaceratesstagelikeoveralertunexaltedshtetlachcovetableretailersliteratestemptablesmalltimeassaultedcatalasesmultiyeartransaxlefiltratedconnatelymetalisedfiltratesvariolatelibelantsliteratusslangiestdeletablegrantableregulatespieplantsdialectalstickablelaureatedlaureatesligamentsmatterfulcatalogedtotalizeseschalotsautolysesrealitiesleafletedlibellantlixiviatefloatiestvariolitemetallicstrawlnetshalitoseschicalotetenurabletraversalzoolatersblastemaslithemiasthesauralearthliertinplatesacrylatesserotinalmetallinetallithesalbertiteautolyzedpulmonatehalitusesballasterpaleolithepauletteoutvaluedphenolateligaturessnarliestendostealoutvaluespastalikeocellatedaureatelyaventailsplacentasgunmetalsanalitiesblastiestsalometertaboulehsinculpatefauteuilsplicatelyretalliedcapitellategmentalplaytimesgluconateblastmentretalliesintervalsciliatelycutlassestorchableweakliestgranulitebeastliersulfatasemultilanesclerotiametalliststapedialalinementteocallislazarettepastelistpectoralsheritablylazarettoantielitetrevallystwaddlersstapeliasunivalentdiametralciliolatedelicatesarterioletularemicpeculateswaterlilyprebattlefellationmetralgialatchkeyscumulatestegularlyetiolatedsensatelytegulatedcalifatestallyhoedwaterlogswyliecoatbutylatedfulguratewaterloosbractletsbutylatesteaselerstreacliercrenelatelateenerslodestarsteaselingtribulateflashtubelapidatedaliteratetenaculumitalicisecoelomatelightfacetabulableteaselledethylatedviolativejaspilitetwaybladeeluviatedethylatesexactablemarlstoneregelatedeluviatesantiulcertenaillestriskeliacrenulaterestoralspalletingfaceliftsallethrinbaulkiestinterlaidcomatulaeslatelikelunchmeatmalamutesfolktalescolocatesalginateschartlesshaulmiestspaetzlesheathlandtailbonespalletisecrapulentblastulaestairlessheathlikegangliatenonmentaltreadlersraclettesrelocateesaintlierlaitancesmealtimestailenderpilotagesvegetablywarstlersseveraltysplayfeetnonmetalstreadlessepitaxialvegetallygangliestjugulatedmetalmarktreadlingbestiallyfurcatelypetallikerectorialjugulatesmalapertstillermanoutleapedtoleratesmestranolballistaepenultimaremittalsinterlapsrostellaretiolatesunalertedteacupfulinterleaftwanglersblatherertruckablewaterleafflatheadsbloatwareisohyetalcuneatelytantaliteendplateshackliestslatternsmelanistsstealableoutlearnsultraredsvenialitydecaliteroutlearntassetlessmelanitesstealagesedictallyelectuarytoleratortoolheadspallettescorelatedsulfuratetailgatesteazelingbluebeatsinterlayscheatablelinealitydefaultedthiazoleslightwaveallotropeteraflopsventrallyflatlinedmethylalsstraddlerelateridsblattereddolabratefishplateanilitiesstealingsstraddlesstreakilyelaterinspleathersballonetslandauletmethylaseelateriteantipolesarterialspatrolmenmethylatedarkliestmontadalemutualizeelateriumconepatlsscaletailnucleatorpintailedclatterereclampticfentanylsagentivalamitrolesreluctateremnantalsilicatessterculiainitialertrialogueclientagebedplatestervalentumbellatebailmentsictericalhatefullyglassiestprelatismhaustellabilobatedselenateslacteallyastrolabefantailedflattenerbiacetylslaterizedleotardedmeasliestadultressalcahestsanelasticcattaloesflintheadserrulatevitalnessinsolatedclodpatesimmolatesinsolatesstellularnavelwortnectarialcandlelitchantableclaughtedcollocatelapstreakhalogetonmatelassemelanotictailpipestesselatetrailsidealienatesfayalitesflaggiestbatfowledtailracesballsiestbatfowlerrattleboxlevanterstapelineseglateresmatelotesoralitiesinterloanlatewoodslineolatecreaturalhalophytetailslideoctanglessegmentalsterilantchartablelevatoresnailbiteroutgambleresalutedcantilenasympetalyepilatinguntunableyeastlessresalutesrevelatorcattleyasalienistsantialienbiathletebrawliestintegralsfistulatemeatballsdietarilyepilatorsantihelixtailwatermilitancerelatedlycatcalledlatherersmelastomestalklessmultipageaerolitesgauntletsxenoblastcatcallerrattailedglutamineerraticalfontanelsgenitalicpalmettesgelatinesatoneableclavatelyslatinessstalkiestlinearityfilaturesaerolithsgantelopegenitivalheliostatradiatelyligulatedentailersbifoliatepalmettosflatwaresmaledictsstrobilaeentailinggantletedtailpiecegalenitespotlacheseglantinestalkliketheriacaltreelawnstriticaleeuplasticgantlinesscientialvolatilessatcheledeucalyptibracteolefeticidalmetallikegantlopespalmatelytelltalestreenailsleadplanttachylyteplateauedrelativesrotiferalmoschatelsulphatedelevatorsbleariestsulphatesmulattoestriazolesalterablycalamitesentoblastcentralercobaltineshetlandsdetasselseucalyptsplaistersmetaplasmplottagesillativeslambentlytraceablyentanglercatalexisplatefulsoleasterscallowestcatchpolemalemiutsexplantedfalconetswhitewallpalmistermalemutesoutglaredplateletsprelocatenucleatedoutglaresgelationsbakelitesnonstapleexultancysafelightlevigatessufflatedthylacineoctennialpalmitateintermalerolamitessufflateskaolinitecingulatelaxativesmetrazolsincitablecopulatesyeastlikeflaunterstablaturealbescentpleiotaxynatrolitebasaltinealuminatejangliestunplantedleviratesalternantanetholessalureticleviraticemulatorstramelingabsoluterglomeratereelevateabsolutesmarblieststaminealsteelyardplatesfulfenestralmelismatatrapezialtrivalentulceratespanetelaswaffliestwavellitedeadlightcalcaratedesolatertelegramsenterallylucubratecervelatschalkiestkeelboatsaliteracyhalteringsibilatedmisalterspearliteslevitatorsibilateslitigatessteroidalpatellatetrammeledantiliferpsalteriacanistelstracheolestartlerspigtailedpretoriallatinizeddeisticalfeastlessestuariallatinizesgustablesserialistcartelisepulvinatedubitabletidelandsgratelesslamellatewastelotstextuallytraplinesfellatingrijstafeldeadboltsdesalterstriennialworldbeatpalatinesfellatiosalkahestscanulatedlitterbagpertussalablegatespalteringcanulatesfatefullytasselingfellatorsdekalitertoenailedflameoutsmitigablegiltheadsdekalitrecartelizemegalithstelotaxesfellatrixseriatelydeputabletelotaxisorientalsunactablevalerateslatitudestablemateunlocatedmentaleseoppilatedwheatlandstablementelemarksoppilatesovertalkstoeplatesvexillatelingulateheelplateboltheadsruralitesspiculatedismalestterminalsdisentailambuletteplatelikesapientlystamplesspeptalkedrecountalmislearnttrivalvesexternalsembattlespeltatelyglaciatestectorialpeltationcabalettaoutbawledlimewaterfatigableuntenablyallotterspinnatelyendoblastcelibatesovalitiesepiblastscabalettescopulatemedalistsstateabletubulatedfeatliestgalletingtetanicalpolywaterwaggliestdeadliftscalotypeschevaletsouthandlepalterersstackablefalsettosaleatoricmetaxylemgranulatecellaretslustratespaltriestpilastersretinulaeisotheralhaplotypeperiplastvaultiestretinularchapteraldiacetylswriteableretinulasstatelieralecithallaboritesstacklesstangentallinoleatetieclaspsfeudalityphthalateplatooneddatelinedultimateddatelinesoverleaptoverplantphthaleinlaetrilescrenatelycapablestsectorialdrawliestvistalesspivotableapetalieslazulitesunstablerfleabitespretravelhastatelypalaestrainflatersclearcutsoutblazedpreadultsreliantlysalimeterreflationlazuritesmousetailoutblazesliteratimdiplomatesoleplateravelmenthypethralouttalkedbaldpatesquetzalessaturablelisteriassalimetryslaggiestdrawplatepointablesodalitestaleggiosoutbleatspretrialslaminateslanguettedelationsmyelomataoutplacedectoblastternatelyacetoxylsverbalistantisleepalgometerfleawortstotalizerunstalkedgiantlikeprealtersdanegeltslancinatewambliestcyclamateplantablerestabledshmaltzessoulmatesanglesitebasilectsrestablestachylitetelepathstutelagesalkylatedalkylatesinternalssaprolitecraterletvenaticalleachiestlifeboatsblastemicalumstonestolonateapostillehatchabletaffarelsteachablyeyestalkslamisterspeccantlyallanitesgladliestgalactosetafferelstangliesttensorialenamelistpalestraeexhalantsplantlikeatenololscriterialhatcheledhelotagesphilatelyjaculatedtemplatespalestralcoelostatreslatinginelasticpalestrasflanneletacrolectsbilabiateexhalentsloricateselongatesaethereallimitabledealationportablesdelectatedangliestdentalitydiastolestangolikebisulfateextraboldpolltakeranthelionlaughtersdentaliumtablefulsvulgarestbloviatedscapoliteclarinetslemmatizesparkletstrihedralcochleatetablelessroseatelychelatorsmegavoltsnanoteslalaticifermaculatesmanteletsplanulatealmageststablesfuldrysalterjacksmelttravelogssatyrlikesylvaniteestimablypapillateshoaliestdelegateevacuolateglidepathcobaltiteproletarydentatelytemporalsretackledlanneretstrochleaeapholatesretacklestabletingultrafineathelingshalftonesstagefulsdelegatortrochleaspendantlypterygialdeflaterstabletopscembalistultraheatreviolatemartellostablettedbiteplatecavalettisprattleddraftableekisticalglairiestantistylesallowestsprattlesthirlagestotalisedoutfabledvacatablepreputialdeflatorsoutfablesawfullestlacertidstotalisesvarietalsilluviatecalyptersleadwortsleftwardsflappiestgastrulaecordatelyheraldistmesoblastvectorialcalenturechloratesklatschesliftgatesliteratorouttraveltwistablefaultiestfiltrableseatbeltsoperantlyfloatableplacatersprecoitalcrawliesttarletansapetalousretailorsstaumrelsaspectualpentanolspercentalfloatagesheathlessmetalisesalienatortentoriallarghettoparietalsverdantlyvirgulatebivalentsdiltiazemcatalexesultraleftplashiestgainliestantinovelcalescentterrellasosculatedbreathilycognatelymaltinesscuticulaemetalistsaccentualosculatestowplanespapillotedisulfatetrilinearpanatelasvalveletsprerectaltabooleysdualitiestotalizedpanatellaauntliestsmaltinesmetalizedstomodealfluxgatessmaltitesmetalizesanalcitesautolysedlegalistslithargesdementialextralityanalecticscutellarmethanolsacetyliseblattodeaacetylizeevulgatedthielaviaevulgatesprenatalssalmonetsdelibatedelaeolitelatter-daybottlecapptyaliseddelibatesearthliesmentzeliaaventaileptyalisessweetmealalectoriarecalmentdulcoratestoneablealectorisemplasterptyalizedloyallestptyalizespanellistboastlessmetallisedefloratetrade-lasthexastyleaerialitysclerotallengthmanemplasticrutilatedsubmentalsweetleafunpotablebeastlikerateablesgoldplateclitellartetraplaszealotismarteriolaoutlashespentathlapearlwortdeltasonerevalentamaturablemonolatertwaddlieruralitiseplacidestvarletessteleostancerealistwell-meantchantlikepastelikeoutlaunceuralitizealbitisedcatalysedlobotidaealbitisescatalyserlavaterasslashfestvarlettosballetingmortalisetriserialsplatchedleitneriaalbitizedplumulatehepaticalsplatcheselastanestreaclingalbitizestephillahunsalutedaplanetictholobatetwalpennycatholytemortalizetenaillonegalitiesvamplatesjoltheadsmoldavitepetillantvegelatesclericateheathfowlstrawlesslychgatesstirrablestrawliketragelaphpetal-likesaintlesslavementstuberalesdumetellacrotalineearthwolfelvanitesunsatableagelasticpetallessampholyteflatettesalleycatsdeathlieraplustresatmolysedchainletstaileronsatmolysesrelocatorstraplikediestrualscarletedstraplineparlementagrestialavertedlypeltandraslattereddialogiteatmolyzedspatlesenmolecaststailfliesatmolyzesrantipolecomptablespatlesestragulinemetamalesmutualisesymmetralpantablesdecalitreearth-ballmangulatedielytrasketorolacmamillatemetameraltequillasfortilagebarthelmesmall-timesalientiaaleuritestolewaresentrailedpantaleonwatermealextremalsmiltiadesprelatessprometalsearthballteraglinsmiltomatepintablestrailableprelatialoutlineararblastercatolytesstealthedbald-patedleviticalelegiastslactifugealligatedprelatieselastancelavoltaedalligatesprelationrupestrallaterisedserratulaapplemintisolativelaterisesvitaliserprelatiserebatableclaggiestsilicatedneoblaststwattlerspallasitehotplatesqualitiedentrallesprelatishballoteesmedullatetailoressentrammelvoltareanunmantledflatshareprebuttaldeliriantpallidestunmantlesplaguiestnodulatedcomb-platenectarealtrialwareastrofellclauchtedtheralitevolte-faceprelatistbethrallsablactatethaliaceaextrorsalpectinealclodpatedmalaxatedaplectrumthickleafprelatizerotaplanesassolitelapstonesmalaxatessoft-pedalmetapeletthalidonebattle-axewaddliestbateleursshootabletailpipedpanthenolwaldflutezelatricelatescentstalinisetetronalsemolliatelambertiavestibulapolianiteanucleatebarruletselastosisrattle-topbattlefulwrathlesslatewakesanorectalstalinizesturnellatessellaeseablitestessellarmytilidaematelotteheptaglotflagitatemayetiolaactualitereinstalscurtalaxeestazolamseabottleeastlingsemptionalzelotypiascathefulritualiseslate-graytellaringslate-greyticklacestrainlessplectaniacheralitelatheriertailwheelventailesinterdealpigmentalpupillatedangaleatlardalitetallchiefoutmantledebatefulventaylesinterrailcupolatedcelastrustuberculaemmenthalslaty-greydecastylestylemarkaltaragesdeclinantrelativalreticellascartellamaleffectdeclinateflaughtedpetrolageastropheldaytalersflaughterplateasmsaltarwisejetplanesstallagesnetballertelluratepalmatureelevatorybiostablerecyclatespinulatedecubitalpalafittesextantaloctastyletrue-falseepeolatrycaprylateareostyletelefaxedcollativechalybitepoeticalsglauriestrightablelaticlavematfelonsniellatedfeldspathuntypablerattlebagcalanthescamoufletsolmizatebatholitehealthismmitrailletelferagetulestomalast-placebleatingsgleditsiabistablescalatheasomoplateslastheniaappetiblealbertismthylogaleuntackledplatemarkfaecalithlambitivelevigatorfalculateuntacklesmitchellaentaylingbeplasterselictarsorleanisthourplatehartlessepetrogalesportablestillagesbloodheatcarrytaleisoetalesmcalesterrattliestlichgatesfaldettasvelaturasrattlinesintenablestypheliataplasheslong-datedsectarialthree-lanetiliaceaelap-strakelatinisedlabellistclavulatelatinisestramlinedlap-streakboutelouabathylitepleonastealternatscalmstonelabetalolethanoylstextorialrentallersealpointstabilatethrappledpardalotecaller-outspangletsthrapplespetrosalsgallanterasphalterpsaltressclimatisestrammelsdratchellthermicalcalceatedcalceatessatinleaftipulidaeserialitysightablemeritablehandtowelpantoufleflameletscartelismsegholatesubluxatemelanittaforestealplatinisecartelistswathableeliminanttremblantervalentavolitatedbeadblastvolitatesdilutabletableforkwasterfulmegalitregold-platetofieldialateen-rigcastellumsexualistsootflakeclimaturemimeticaltaxiplanetelematicfossulatevernalitypotwallerephoraltygalleristwheatmealasystolesroyallestsalicetumtamerlanemelanotisburlettasfallowestsegolatesapplicatetrivalvederythemalethericalsexvalentlectoratedataglovemelastomatanalisedumbratilevaletingsbalconetslustiheadtanalizedingratelydivalentstremolantslabbiestdatallerstetanillaeudialyteanabolitehelvetianpalstavesallotteryzettaflopo'flahertyhellicatsstanchelstalbotypechalutzessnailiestostiolatechatlinessigillateepiphytalscrattledslabstonestrekeliavaultagescasquetelexoplanetscrattlespennatulacalcretesfeaturelysquattledpeatlandspyrolatersquattlesstateletstalckiestouthaulertremulatevapulatedvapulatespleonastsbaculitescellaristmentorialteleosaurvaultlikesceleratesemblantslocellatestatelilybluntheadepulationheartletssceleratsmalleatedthreatfultrancedlyheartlingchaptrelsmalleatesenvaultedalectryonwaghalterantelucanbittacleslaevigatelarvikitetriglidaecleanthesselenatortriglinaereistafelactualiseoverplaststellariatotalisertonalitesautocyclesteelwarebiliteraltabellionhesternalbutleragelisterialsittellastalegallalekgotlastwo-leafedfragilestwaltzlikeimmantledtwo-leavedimmantlesdatoliteslatergrambalectionkarlfeldtgiantlierinflativebattelersheart-leafhitlerianoutplacerurticalesalaimentsbattelingsalt-curedcratefulsharestailbattelledchamelotscorallitelabouritelight-yearverbalityprolativeplantagesalembrothtaligradesweatlessterebellaunhealthsacetylidenephalistaglossatecautelouseviternaladdlementgoslaritecapelletsstandgaleungulatedautoflareslaistersclaretingslaisterylabrocyteelettariacephalatetrevelyanlabroustemellitateplantlesscetywallsthessaliatandearilinstalikeemblematahariolatelaughiesttentaculaflustrateplumbatesbandeletsdeath-rollphacolitelemmatiseceylanitehalf-casteteachlesslithonateallativesarillatedunpleatedmalmstonelaccolitealdactonetradelessheartleafobovatelyperiblastplantulesacetaldolsupersalttalkboxesallaymentbarbastelbattilledkalinitesvalproateliatrisesdiastylestalkfestsgremolatahomestallpentalogyfrailteesbattlebuslaserwortunratableeutrapelypentalphamalonatesthelarcheateliosislanolatedmartelledfirefloatplanxtiesprotealessolidatedkallitypesolidatesmouthablekineticalstercoralhylobateswhitelashbabbliestmarialitelatinesceholderbatblanquetslacertiantablewiseportatileatheologyhospitalecalypteracolumbatesweet-talkplaquettevitellarystaphyleabombilatekalotypesclartheadlacertinemaltalenttelesalesseptlevaslanterlooarchlutesclartiestlaicitiessublunateheadclothbidentalsdeplumatelanternedmotorablefoliatureconsolatevulneratebreathfulirrelatedbivalvatetalliablebackplatecastelessplaccateshalieuticcleithraltrilemmasrecitablecraftlesstalliatedearthfallpendulatewaistbeltrecruitalmethanalsstapleguntalliatestittlebatblashiestpetalismsattolaserhalimotesregalistsshaftlessearthflaxathelstanblattellapetalodicuntirableliparitesmillettiaattollensblattidaeannulatesattollentballanted
Phrases (334)
little aukplant lifegreat sealtank shelltidal wavetv channelstone wallbleach outold mastersoup platebean plantrelated tobabble outseed plantedible fatair letterget-at-ablepelt alonghotel plantalk termsapple tartwhite flagapple treebeef plantmare's tailhome platecancel outhell to paysea tanglehair stylemetal drumreal stuffreal thingall at oncelove matchflat benchill at easeleft braincattle penpatent logall the waytell apartbolero hattable talkdeer trailwater fleawax myrtlework tabletake a looktilt angleglide pathlegal dutywater holelight beamblack kiteadult malebelt alongwhite tailbelt makerpulse rateset aflamecold sweatsweet balmdeath bellplane seattake placeblast wavehalf titlestaff linetravel kitparcel outfoot pedalunequal togenus lotaalder treeheir-at-lawomelet panblood heatcard tablehard steelstar appletea familybill gatesair castleface towelherbal teatidal borepier tablestay relaytea parlortrawl linevol-au-ventflame treedelta ironplayed outterra albatidal zonelake poetsdelta wavedelta wingpipal treeslack tidebristle atgreat wallstar shellhigh tableair filterlake tahoelake troutlake tsanatype metalcereal oatsales talkholy watertin plaguelake voltalech afterto leewardbest of alllunch meatmyrtle oakold stagersingle taxjungle catvelvet antsteal awaylie in waittaste celllike a shotdasht-e-lutpool tableelan vitalevery lastapple mintcut of vealsable coatmale chestapple rustslang termsteam coalwild wheattowel racktowel railbell metalaltar wineflare pathsea slatergravel pitflare starsteam linelocal timemay beetlecalyx tubeilama treeovate leafcar rentaltear glandlead plantlead sheetlead storywhite leadair travelrattle offsea turtlesoft scaleslate clubtall ordertrail bikepalm civetparty lineslate rooftrail headshot metalmetal woodlove feastbath gloveblack beltbath linenlive steambetel leafcattle cartesla coilbetel palmall get outalma matersteel bandill healthbath towelpaint leafangel dusttaper filein realitypatent lawfolk metalill natureblind datelust aftergrid metalsteel graypoint laceleft stagebase metallast ritesla fayettered planetcoal chutefan lettersteel trapoil carteltable gametamale piewidal testtable lampart dealershovel hatstate linebay myrtlegarnet lacoil heatertable saltj particlesatin leafin the leadwhite salehold waterlate greekhealth spalate latinclaret cuptable winefalse smuttake a leakrear lightpoll takerr. b. cattellplate ironwrit largeplate racksloth bearplate railraw talentankle bootcell deathsaint lukeoil tankerbland dietnote valueneural netdefault onsleep latelose trackwater lilywater lineat leisureray floretcape tuliproad metalset ablazelaptev seawater milleight ballwater moldau naturellost causecold waterheart lineagate linetoilet bagtotal heatinter aliatake leavemental agee. t. s. waltonlarch treeallen tatebattle crywater pillk particlegas helmettrash pilekick pleatwater polobowler hatmatzo mealplane treeland agentveal roastsweet flagempty talksweet galealpha testoral stagedeath tolltime scalewall plateof all timeroast vealclub steaksalton seaanal stagehand towelgreat dealfault linelogic gateemser salttime valuetitle pagefairy taleaztec lilymole plantmill agentbite platetoll agentgreat hallwu dialectpeanut oilbaltic seasolar timetrade billwater volewell watertoll takerhazel treelay to restlook aftercoral treeface clothhot cerealheat flashstage leftplant cellstaple gunshort salepole vault
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen