9-Letter Words Containing: H,A,F,T
(In Any Order)
There are 140 9 letter words,
39 9 letter phrases and
0 9 letter abbr's with
H,A,F,T in.
Best Scoring 9 Letter Words With: H,A,F,T
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
|---|---|---|---|---|---|---|---|---|
| jackshaft | 9 | 28 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| makeshift | 9 | 21 | adjectiveadj | |||||
noun • something contrived to meet an urgent need or emergency adjective satellite • done or made using whatever is available | ||||||||
| halftrack | 9 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| rockshaft | 9 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| flowchart | 9 | 20 | nounn | |||||
noun • a diagram of the sequence of operations in a computer program or an accounting system | ||||||||
| whiteface | 9 | 20 | verb, adverb, nounv, adv, n | |||||
noun • hardy English breed of cattle raised extensively in United States • a clown whose face is covered with white make-up | ||||||||
| chaffiest | 9 | 20 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| platyfish | 9 | 20 | nounn | |||||
noun • Certain fish of the genus Xiphophorus lacking a sword-like extension of the lower tailfin. | ||||||||
| facecloth | 9 | 19 | nounn | |||||
noun • A flannel for washing the face. • A cloth laid over the face of a corpse. | ||||||||
| khalifate | 9 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
All 9 Letter Words
Words (140)
godfatherhereafternightfallheartfeltfirsthandaftermathchieftainfeatheredmakeshiftfaithlessheadfirstshortfallmineshafthealthfulhalftrackforsythiahandcraftintifadahgearshiftflashiestfightablechairliftfatheadedcatfishesflowchartforgatherhomografthifalutinwhitefacefaceclothkhalifatefaithfulsintifadehaffrightsfatheringfootbathsfathomingshiftablefootpathshaftarahshalftimesholdfastsheatproofantitheftsoftheadschaffiestratfishesflashtubelightfacelightfastsubshaftsfarthingsflatheadsloanshifthandfastsfanlightsfishplatehatefullyflintheadbatfishesthreadfinshamefastsafelighthoofbeatsfraughtedfishtailsfathomerssoothfastmisfaithsheartfreejackshaftplatyfishcamshaftshaftarothcatfightssheatfishhaftorahshaftorothhalftonesrockshafthoarfrostshaftingsrankshiftfightbackslashfestbushcraftforthcameheathfowlwafer-thinearthwolffishpastekhalifatsfaithcureflatsharethickleafairshaftssheafiestfratchetyfratchierfratchingscathefultallchiefham-fistedflaughtedflaughterkhilafatsfeldspathfastnachtfaecalithfraughterhandstafffactsheethomecraftlayshaftsfather-godforeteacho'flahertythreatfulthiofuranunfraughthamfatterafterheatheart-leafmanshiftshalf-trackhalf-casteaftershowfatwahingheartleaffughettashalf-lightwhipstaffhalf-staffbreathfulhalf-truthearthfallheadfastsearthfastshaftlessearthflaxPhrases (39)
white flagedith piafout of handflat benchcall forthfight backcatch firehalf hitchhalf titleget a whiffstay freshthrow a fitfish steakfisher catlech afterfall shortchair liftflare pathwatch fireflip chartcohune fatsoft wheatfifth partbutt shaftninth of abninth of avfat chancegood faithhave it offhuman footfrat housefirst halffair catchgang fightfaith curesafety hatface clothflow chartheat flash
