9-Letter Words Containing: F,H,L,T
(In Any Order)
There are 124 9 letter words,
24 9 letter phrases and
0 9 letter abbr's with
F,H,L,T in.
Best Scoring 9 Letter Words With: F,H,L,T
Expand? | Word | Save? | Length | Usage | Points | Type | ||
---|---|---|---|---|---|---|---|---|
flyweight | 9 | 22 | noun, adjectiven, adj | |||||
noun • weighs no more than 115 pounds • an amateur boxer who weighs no more than 112 pounds • A weight class division in combat sports, often the lightest. | ||||||||
halftrack | 9 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
flowchart | 9 | 20 | nounn | |||||
noun • a diagram of the sequence of operations in a computer program or an accounting system | ||||||||
platyfish | 9 | 20 | nounn | |||||
noun • Certain fish of the genus Xiphophorus lacking a sword-like extension of the lower tailfin. | ||||||||
frightful | 9 | 19 | adjectiveadj | |||||
adjective satellite • provoking horror • extreme in degree or extent or amount or impact • extremely distressing | ||||||||
facecloth | 9 | 19 | nounn | |||||
noun • A flannel for washing the face. • A cloth laid over the face of a corpse. | ||||||||
khalifate | 9 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
flightily | 9 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
bullfight | 9 | 18 | nounn | |||||
noun • a Spanish or Portuguese or Latin American spectacle; a matador baits and (usually) kills a bull in an arena before many spectators | ||||||||
healthful | 9 | 18 | adjectiveadj | |||||
adjective • conducive to good health of body or mind • free from filth and pathogens | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
All 9 Letter Words
Words (124)
nightfallheartfeltfrightfulnightlifefaithlessbullfightfleshpotsthreefoldshortfallfilthiesthealthfulhalftrackshiftlessfirelightpreflightfulbrighteightfoldflashiestfootlightflechettethrillfulfightablechairlifttopflightflyweightflowcharthifalutinruthfullylithifiedlithifiesblithefulfaceclothfleshiestkhalifateflysheetsfaithfulsshopliftsshiftablefootholdsthriftilyhalftimeshurtfullyholdfastssoftshellflashtubelightfacelightfastheliliftsflatheadsfleshmentloanshiftfanlightsfishplatefletchersfletchinghatefullyflintheadfishboltsblueshiftflichterssafelightstenchfulthrustfulflightierflightilyfishtailsflightingtheirselfchestfulsfootclothfoothillsplatyfishflitchingpilotfishhalftonesmouthfeelmouthfulsstill-fishlengthfullothefullplightfulslashfestheathfowlearthwolfunhurtfulthrongfulhillfortskhalifatsflatsharethickleafscathefultallchieftoothfulsflaughtedflaughterkhilafatsfeldspathfaecalithtwelfthlythree-foldtheftlessforeclothlayshaftseightfoilself-wortho'flahertyeight-foldthreatfulheart-leafflushiesthalf-trackhalf-casteheartleaffrothlessshelfiesthalf-lighttop-flightthirstfulhalf-staffbreathfulhalf-truthearthfallshaftlessearthflaxPhrases (24)
to the fullwhite flagflat benchcall forthhold forthhalf hitchhalf titlefish filetget hold ofrifle shotlech afterfall shortchair liftflare pathchoir loftflip chartflirt withfirst halfwhite wolfnight lifeface clothflow chartheat flashflow sheet