Dictionary Only:
Profanity Off:

10-Letter Words Containing: M,Y

 (In Any Order)
There are 1,514 10 letter words, 219 10 letter phrases and 0 10 letter abbr's with M,Y in.

Best Scoring

Expand?WordSave?LengthUsagePointsType
zygomorphy10
33 nounn
Valid word for Scrabble US
rhythmized10
31 verb, adjectivev, adj
Valid word for Scrabble US
exoenzymes10
31 nounn
noun

• Any enzyme, generated by a cell, that functions outside of that cell.

mythicized10
30 verb, adjectivev, adj
verb

• interpret as a myth or in terms of mythology

• make into a myth

rhythmizes10
30 verbv
Valid word for Scrabble US
zombifying10
30 verb, noun, adjectivev, n, adj
verb

• (fictional) To turn into a zombie (a member of the living dead or undead).

• To take control of (a computer) in order to use it covertly and illicitly.

sympathize10
29 verbv
verb

• share the feelings of; understand the sentiments of

• be understanding of

• to feel or express sympathy or compassion

mythicizes10
29 verbv
verb

• interpret as a myth or in terms of mythology

• make into a myth

mycorhizae10
29 nounn
Valid word for Scrabble US
complexify10
29 verbv
verb

• have or develop complicating consequences

• make complex

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (1514)
completelymysteriousmotorcycleultimatelyunemployedemploymentelementarymelancholymissionarymayonnaisemontgomerypresumablygymnasticsremarkablyenormouslycommentarysimplicitycompulsorycomplexitysympathizedeploymentsimilarityintimatelysystematicmagnifyingembroiderychemicallycomplicitymistakenlymediocrityadmittedlyterminallyhandsomelyfemininitysynonymousflamboyanthieronymuscountrymaninformallycosmicallyunmilitarypyromaniaccommissaryimmoralitycriminallysymbolizedabnormallymaniacallymoderatelylymphocyteconformitylegitimacymisogynistarrhythmiapromissoryimproperlysympathiseimmaturityimpossiblyinhumanitynumerologylachrymosecharminglyimplicitlyimpeccablyvehementlyproximallyyardmastermilitarilyhomeopathymoneymakerswimminglymercifullycryptogrammorphologymateriallymystifyingmetallurgymournfullymyocardiumdynamitinghumorouslytomographymastectomymyocardialhypodermictomfoolerygastronomydaydreamercompetencyalarminglymolybdenumlycopodiumsymbolisedecchymosisimmobilitymindlesslydemonologyuncommonlydramaturgymenacinglyasymmetricmortifyingpolygamistshamefullymusicalityhighwaymandisharmonypatronymicamplifyingbloomsburymarginallymalignancyabominablyseismologyremarryingseamlesslyfamiliarlycavalrymanhematologylumberyardarrhythmicsmashinglyepididymiscommunallyinimitablysystemizedtiresomelyparoxysmalsanctimonyconsumedlyalimentaryuniformitylaundrymanharmlesslyentomologypermanencyimbecilityjourneymanrhythmicalambulatorymicroscopymetaphysicmatriarchymusicologydefamatoryreassemblyepisiotomypromontoryimpudentlyperemptoryluminositypolygamousmisogynousincumbencygymnasiumsequanimityimmaturelymultistorylamentablyprepaymentpolytheismnecromancygruesomelynonpaymentmonetarilyinfamouslymanifestlyembryologyhypodermisunmaidenlyminstrelsymysophiliahemoptysiscyclotomicphlebotomylymphedemadementedlyaureomycinmammillaryimmortallyclypeiformmycologistspirometrymycoplasmainhumanelyformidablydysprosiummodularitymixolydianmineralogyimplacablyhaemolysishaemolyticaudiometrycompatiblymeasurablyeffeminacycraniotomyerlenmeyermagistracymysticallypolynomialamiabilityimminentlymyastheniaimmodestlychiromancylaparotomyemployabletemporallymethylatedsymbolicallumpectomymartyrizedadmiringlyrailwaymanintermarryimpolitelysymposiumsbiodynamicmiscellanyvancomycinunmannerlymythomaniaimprobablylonesomelytemptinglymutabilityredemptorysymbolizertimorouslypolymerizemonogynousadmonitorymaternallymythologicaneurysmalinclemencycomposedlyamygdaloidmonaurallymendicancyundismayedmirthfullyhydrometermyelinatedimposinglymitigatoryimpotentlymovabilitymerrymakersomatotypelukewarmlymuliebrityviscometrypolychromeplaymakingcyclometertympaniteszygomaticslampoonerycyclostomemonohydricruminantlymovelesslysymbolisesmummifyinghighwaymensymbolistsmonolayerscollyriumssymbolizessymbollingplasmolyzehemelytronhemelytrumimperiallyendothermyovermightycycloramichermatypicimmaculacyhoneymoonsmalapertlymicrifyingkanamycinsmultilayeracrylamidehypermanicrhymesterscurrycombssymphonistdamaginglymuscularlyheteronymsbiopolymerrecumbencydaydreamedsympathiesimmoderacyqualmishlyimportancyrhythmizedpolychromyoxymoronicpresumedlybiorhythmscymbalistsmollifyingmisplayingrhytidomesbumblinglyanimatedlytympaniststrichotomysynergismsrepaymentsamendatorymisemploystumultuarysybaritismeurhythmicfumblinglyamnestyinghybridismsdamnifyingmicropylesasymptoticformlesslymythicallyantonymousmicrocytesmicrocyticsystemizesambrotypesmythicizedmacrocyticmycologiesmyeloblastjourneymenmythicizesecosystemsmycophilespropylaeumnamelesslypyroceramsvoyeurismsmycorhizaehamadryadsleiomyomasdominantlymythmakersmythmakingmodulatorycomplicacymycotoxinsembaymentsactomyosinmythologerreemployedmonocyclicmyelitidesovariotomyblamefullysemiyearlybecominglyremediallyfilmicallykerygmaticsubsystemsunmoralitycomparablypachydermsenjoymentsemblazonrypolyatomicmesenchymekaryolymphmanslayersgladsomelyecchymosesterpolymerecchymoticproenzymescomicalityhumblinglydynamisticprimevallypolymathichumbuggeryluminouslytoilsomelycataclysmsgymnospermenthymemeshypostomescompanyingparenchymacavalrymenpolymorphslachrymalsmiddlinglypolymyxinshomozygotehypodermaldairymaidsplaymakerscopolymersisoenzymesimaginablyisoenzymiccumbrouslymonogyniesmesophyticimpassiblytympaniticcytoplasmsnomographythymectomyaerenchymamartyrdomszygomorphybimanuallymillihenrynurserymanthymidinesstylitismsmyologistsheterogamyinformedlymisogyniesmemoriallysymmetrizeeuonymusesacromegalythymocyteshoneycombssemidryingmoneywortssymbolismspaymastersplasmogamymartyrizesvenomouslyimpudicitymutinouslypolypariumpoultrymanmyopathiesdidynamiesnematocystytterbiumspolyamidesxylotomiesmedievallymyopicallyosmolalitypolyaminesantifamilyhypanthiumbimodalitymidnightlyosmolarityphotometryencystmentremissiblycycloramasungimmickymissiologycountrymennematologyhormonallypolymerasefearsomelymyositisesemissivityspymastersdiseconomyhypermaniahypnotismscarbamoylsmyosotisesmetricallypolymerisecoemployedanemometrypermalloyscockneyismzymologieslongsomelycondylomasamplidyneshypermeterinimicallymonohybridhemicyclessymmetriesarmoriallyzymometerstrimonthlygendarmeryheteronomyhypoxemiasjambalayascyanamidesmethylasesmicropylarhylozoismsmethylatesnurserymenbigamouslyrifamycinsmethylatordoomsayersholoenzymedoomsayingantonymieshymeneallysymposiastdoomsdayeratomicallymethylenescomplexifylymphaticsstyrofoamssympathinsmesophyllsmicrophyllchirimoyasmanageablymesophytesneodymiumscompliancyrhythmistsperilymphslymphogramastrometryanemicallycommonaltykymographshydroniumskymographyrhythmizeslymphomatasympatriesmyrmidonescymbaleersgravimetrycoryneformmelaphyrespolyrhythmmyrobalansendemicityhymnodistsunrhythmicmosaicallyexoenzymeslymphokinecandygramsbinomiallyperimysiumcherimoyaspigmentarymanifoldlysymphoniesdithyrambsascomyceteapoenzymescaconymiescymbidiumsacidimetrydisemployscohomologyhypsometerhypodermascryometersmetonymiesmonkeypodsyuppiedomsmultipartyseminuditymonkeypotssymphysealpolysemiespyrethrumssemiweeklysymphysialprotoxylemlathyrismsmyxomycetemystagoguepolysomicsmusicianlycymographsmyasthenictimelesslyflunkyismsyohimbinesmitomycinsmollymawksdehumidifycymophanesamygdalinsdysthymiasmysticetesamylolyticvitrectomymysticismsdysthymicsborborygmimegacycleshemizygoussymposiacspolysemousmystifiershypermediasphygmuseshydromancyparonymousamblyopiasamoebocytehybridomasmycetomatamisallyingmisstylingmosquitoeymycetozoanmolybdatesparamylumsplyometricamyloplasthemocyanineurythmicsamylopsinsmetastablysyncretismbathymetrypolygamiesmycofloraemycoflorashypolimniadysphemismamyotoniasasymptotesjunglegymsmacrocystssystemlessnympholeptmacrocytessomatologymeromyosinmetrifyingdasymetersmythicizerpolygamizedemographymatronymichypomaniaszombifyingsegmentarymelanocytehypomanicshemolymphseverywomanhomonymieseverywomenhemolysinsterminablyhypomorphsmycorhizasroyalmastsmycorrhizahemolyzinglamentedlycryptogamsnonsystemsparanymphsgametocytemourninglycysteamineendoenzymedreamfullymonocotylsimmunologyeurythermshemoptyseserythremialysimeterssynonymieseurythmieslysimetricembryogenyyeomanrieshyponymiesendolymphserythrismsmetaxylemsmydriaticsepiphytismgamesomelypolygonumsmisassayedsynonymizecyclamatesmonocyclescryptonymsamebocytesmonorhymedautumnallykerseymeremonorhymessynonymistsynonymitynymphalidsgoniometrymyelocytesmyelocyticsyllabismsimmanentlymilitantlymacrophytenymphettesmyelogramspreprimarysemeiologyramblinglymiscopyingmythopoeiaorismologyreadymadeskaryosomesbipyramidscoulometrymythopoeicchlamydialmyelopathypyramidingsubeconomyimpalpablycytochromemisrelyingoversimplymayflowerssyntagmatawomanishlyendomorphystepfamilyhygrometermetagalaxysyllogismsradiometrypolyimidesberylliumsblimpishlymayoressesdynametersantimonylspyromaniascopaymentsmayorshipstoponymieshyaloplasmtoponymistpoultrymenchlamydiaepyrometersmyxamoebaepyrometricmyxamoebasnumerouslyantimycinsmalacologypuromycinspycnometerhyperemiasenzymologypyrimidinehomonymousdynamiterssociometrymyxoedemastryptaminedictyosomelimitinglyminelayersepisomallypterygiumsseismicitypseudonymsmyxomatousgerminallydaunomycinemphysemaspolymerismemphysemicfemininelypyelogramslaundrymenhypocorismsemicolonymyofibrilsnonenzymicimpartiblydynamotorslincomycinlocomotoryoptimalitymeasuredlyphyllodiumcommanderyemeticallyepididymalmethyldopainnumeracymyoglobinsevonymusespremycoticshaggymaneimpassablymistrystedhomozygousmesomorphyuropygiumsmultifidlykeratotomygamynessessomnolencymonographysymbolisersymbionticmesophyronmonogynianpotamologysclerotomyirremeablyiridectomymawlamyineypsiliformhygrometrymumblinglyhymenoptertympanitismisogynismhypericumscyclometryadactylismmattifyingtraymobilewhitmondaypranayamasgnomicallychemitypesmerchantrydolesomelyzygomyceteperomyscuspsychopomppyromancerpaddymelonmyologicalwykehamistxylometersamaryllidsthymidylicpolyominosclistogamymartyrisedmyomanciesadriamycingeodynamicmartyrisesdyothelismmenyanthespolyonymicgymnasiastsymmetriseoxidimetrymastodyniachromakeyspodilymbustemulentlybiomimicrymooseyardswyomingitepyknometercumulatelymyomectomydisamenityzygospermsmercifyingpaynimriesplasmolysemamaguyingdidynamianterramycinpyknosomesimmisciblymyophiliesxylorimbaschemonastystaphylomadidynamousmyophiloushyoscyamusemigratoryethylaminestaymakersstegomyiasacronymousxylotomistgymnosophsmarylandermicrometryxylotomouscosmolatryoxydendrumhemelytralhoneymonthtallywomanhomoblastytallywomencomatoselypolyhymniastylometrypiezometryampholytesmediocracyodorimetrycapnomancycockneydomminglinglymonoxylonsscyphiformmonoxyloushomochromyhypothymiamarketablymonozygousbradyseismaxinomancycymatiidaemesognathymysophobiagynaeceumsscheminglyfoetometryeximiouslymysophobicatmolysingprozymiteshyperaemiaimpeccancysymphonisehypermartsiconomachygempylidaeelytriformhoydenismssymphonizetautonymiczymologistmonogynistatmolyzinghomoeomeryparalympichydromaniachromatypecyclothymesystemisermyriadfoldsymmetrianhylotheismhypoxaemiaremittencytrimminglysystemizerlymantriidhemicyclichypoxaemiciconometryphysicismshemielytralacrymatorstrychnismsymphysiontamabilityhackneyismdefraymenthylotomousimbecilelyjamahiriyamicroarraymyriapodanemmenologyuranometryambagitoryhackneymanimpedinglymetronymicpolypidomshackneymenpsychicismcleromancyenterotomymyringitissyphilomasgrumpishlygynandrismpelvimetrystereotomymoucharabymegalocyteanonymiseddysmorphicmetroxylonanonymisespyramidionprominencymultiloquyachromycinpyramidistplasmacytechordotomymoygashelsambystomidmundifyinganonymizedmyrioramasanonymizesmyrioscopemetacyesischylodermapresbytismhemimorphyherniotomymammectomypyramidonsdacrymycesrhythmisedmillionarymonaco-citydyer's-broominpaymentsrhythmisesskimminglymelanositybrachycomemayacaceaedeformedlymayakovskimicrophyteunmarryingpreemptorycymagraphsmugwumperyhyperosmiaheliometryseminalityclammyweedsimulatoryplastogamyrhythmlessheavy-armedarithmancytimberyardhymnodicalsynaptomyspadymelonsdrymarchonchirognomytachometrypermutablyaxonometryskimpinglysymphiliesomniparityphrynosomasymphilismrhythmuseshypozeugmamyxinikelasymphilousanemophilyhymnologichypericismmyxinoideagolomynkasmillocracymyrtaceousmyxinoideijumblinglycherimoyerminifloppybabyminderaccumbencymyxobactersymphoniontimbrologyhyalomelantauromachymanawyddanpolypodiummonkeyismsmummy-brownhypsometryamygdalineascomycotacryometricsymphylousorthodromyyiddishismtumulosityflunkeydomambiophonyhyalonemasclamjamfrygargoylismtobramycindynamitistcymiferousmystagogicmendeleyevgramophonycyanometermouldywarpflunkeyismabnormalcyseptectomygynostemiasymphysticunsymmetrypolysomiesmyxomycotapromptuaryimmoveablyfrumpishlygenyonemusmystagogusamylaceoustridymitespostliminyjumhouriyaunblamablyunsympathymollyhawksphylliformseemlyhedssymplastictachymetryamygdalatechromotypesquamoselyglycaemiasshamiyanahimmotilityalmond-eyeddysthymiacoutmodedlypsychogrambathometrydecumbencyamylolysiscohyponymscometologysquamositycyathiformstylomecontimenoguysunsymbolicmycostatinpolysemantcymotrichysquamouslymycosterolnoumenallyparonomasyallonymousamyotrophyiambicallymycetologyparchmentymoskonfytsparonymiespetromoneypromyceliaparamouncychasmogamymid-januaryamylolysespediamycinmythicisedsystemisedphillumenymyelateliapycnometrymythiciseryammeringsscampishlycynomolgushydrometrysystemisescompletorycormophytemycobiontsmythicisesbathymeterzygnemalesfumigatoryuntameablymacrocyclemistakablymythicismsphenacomysdifformityuterectomypolygamisemolybdosesmythicistsmetaphysisminelayingmolybdosiseponychiumlamellarlygloomfullybisymmetryhydrosomalmixabilitytriumpheryhyperaemicjockeyismsmeronymiesherrymentspetromyzonhydraemiaseye-beamingaldermanryhydrosomeschymifyingkryometerscotyliformcarbomycinepimythiumclaymationparoxysmicmatsyendralimacologytermagancypantrymaidzygomycotahomebuyerscandymakerphilomathypachydermametatheorymonochromysynoecismspottymouthriyal-omanihemolysinghomonymitypogonotomypolygenismmycorhizaluntermeyerlysichitumhaemocytesasystolismdichromacycompliablymenotyphladichromasycryptogamyplanimetrynameworthylysimachiasynandriummylodontidepiphyllumgeminatelysmirkinglyspodomancymoribundlylampyridaeneurectomycystectomycatathymiahaemolysesrailwaymenpleomorphycybercrimesynonymiselysimachushomoplasmysalicylismmetrostylecampimetrycartomancyrhinophymasematologymimographydocimologyeudiometrymuritaniyahomoplastyarraymentsthumpinglyassuminglystimulancyunmanfullykaryogamicembryonatehaymakingstemerouslypleximetrymegaphyllsstormfullymeddlinglykaryogramsminivolleymyelitisesnymphaeumsmonocytoidhomocyclicmacrophylametecdysesmetecdysisstrabotomydiachylumsembryotomybaldmoneysremediablygammopathyembryulciavibramycinmythomaneshyemoschusthermologymonadologypathognomymyometriumdismaylingtypomaniasplanometrygametogenychlamyderaminatorilyhematocystmahayanismmahayanistassythmenthomeotypicovertimelyarhythmiaswomanfullyectomorphycompactifycyclicismsgymnadeniatachymetermussorgskymyosarcomawamblinglyanadyomenemassymoresectoenzymeunmotherlypolyangiumhieromancynystagmoidcomponencypachymeterfujinoyamamansionaryhimalayishmythopoetsdismissorycystostomyredeemablychiyogamisminimalityproembryoshomothallydensimetryhouyhnhnmsecchymosedtrendyismsyestermornracemoselyburramysesmylohyoidskaryoplasmprettyismsmatroclinymytiliformdynamicistlithomancyracemouslypolylemmasnumerositypyromantichomothermymiscreancysupplymenttoponymicsunmoveablypyromeridechlamydatedynamisingpolymastiaclinometrymylonitisemalaclemysdeclomycinchlamydiaspolymastichaemolysinhomomorphytemporaltyemendatorypromythiumsumerologyhinayanismdynamitardallaymentsisocrymalsmuddlinglypyrilaminegymnopilusmylonitizepararhymeschimneypotchimneyingchomophytemonostylarhygrotramahomotypiescalyciformvaricotomygymnorhinabotrychiummyriameterwaymarkingmyxoedemicfeminalitypolymeridemyriametresomniloquymistraynedhyetometerremercyingdynamizingemergentlypolymeriesgymnosophysynthetismwaymentingmanticallymulticyclemyoblasticmorphogenyimprovablymatroyshkadreaminglygastrotomysomniatorynominatelydynamogenyfeminilitymyricaceaematryoshkaaldermanlypleurotomyzygantrumsmandylionsmatryoshkimissayingsxylochromehyphenismsrhodymeniamistresslyimpulse-buynephrotomycordectomymastopathyadenectomyvariformlyalmightilypolymerousamphictyonathermancyhomostyledrachiotomybrachydomehomostylicimpendencyrumblinglysymbolatryvulvectomyaraeometrysalmagundymesitylenetrotskyismcytometersagamicallyisodynamiccytometricnamby-pambylachrymarybombycidaemyographichydramniosnigromancybombycilla
Phrases (219)
mary leakeybombyx moriroot systemfamily linemoshe dayanmt. mckinleymaxim gorkyemery clothemery paperyemeni rialready moneyyard markerfamily unitgrey matterbaby minderunix systembaby's dummysmart moneymetal moneyin name onlytight moneytone systempalm familyutility manup to my necklist systemoil companypink familygray marketgray matterhenry jamescherry bombglycine maxhenry mooremaster copypaper moneywater nymphfirst of maymaple syrupbasil thymethomas graycompany manhume cronynjames joyceflax familytime of yearcity limitsempty wordsarum familyolympic godcommon lynxjumper stayby all meanspernyi mothearly morelworm familyflame tokaymary mallonstay-at-homesystem callmary martintom bradleysea lampreymary stuartiris familytype familyfamily treewillie mayshockey gamecebu magueyfree rhythmmyrtle birdrhyme royalmyrtle flagsam goldwynhockey teamoxygen maskswamp buggyitem-by-itemos hyoideumdry masonrydry measuredummy whistemery stonemint familymoss familycroo monkeyemery wheelyemeni filsdry mustardprize moneycar companyopium poppyperry masonfemale bodypine familybaby boomerrailway mandumpy levelcore memorylymph glandhemp familybaby farmergrey marketbird familygrey mulletyerba mansagenus bryumsun-ray lampbeta rhythmchinese yamheavy creammemory chipcommon yearmemory lossplume poppyheavy metalform familylee yuen kamwoman's bodyonyx marbledata systemdirty moneypalm sundaymoray firthrush familyedna millayfamily filmvirgin marymass energymother's boycheap moneymother's dayrose familylily familymarsh buggyfamily roommexico cityjury systemimport dutythymic acidgray mulletsurvey milegerm theorymoreton baylady's smockmorgan cityroman deitybay-rum treelens systemaloe familymoney orderpretty muchgame theorymoney plantpygmy mousesunray lampcherry plumfamily namefancy womanlamprey eelmotley foolfanny adamsmeadow lilygas companyvowel rhymeyoung womandowny bromepetty morelfuel systembus companymerry bellsmontego baypanama citymurphy's lawmalt whiskyfern familyimpala lilymickey finnrome beautyflying bombwealthy mantiti familyfile systemsand myrtletiti monkeyknock rummymark antonyprompt copycave myotistoken moneydark comedysum of moneymyotic drughaying timelion monkeybuy the farmramon lullyflying marehigh comedyjump for joydog mercurybombay hempcommand keymelody pipemyrica galesafety lampjames wyattsky marshalbody armourfish familygloomy deaneddy merckxdonkey pumpdrum memoryplay possumjimmy hoffablood moneygenus mysis
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen