Dictionary Only:
Profanity Off:

10-Letter Words Containing: C,E,H,I,N

 (In Any Order)
There are 576 10 letter words, 61 10 letter phrases and 0 10 letter abbr's with C,E,H,I,N in.

Best Scoring 10 Letter Words With: C,E,H,I,N

Expand?WordSave?LengthUsagePointsType
chimpanzee10
28 nounn
noun

• intelligent somewhat arboreal ape of equatorial African forests

mechanized10
27 adjectiveadj
adjective satellite

• equipped with machinery

• using vehicles

xenophobic10
26 noun, adjectiven, adj
adjective satellite

• suffering from xenophobia; having abnormal fear or hatred of the strange or foreign

mechanizes10
26 verbv
verb

• equip with armed and armored motor vehicles

• make monotonous; make automatic or routine

• make mechanical

mechanizer10
26 verb, nounv, n
Valid word for Scrabble US
squelching10
25 verb, adjectivev, adj
noun

• a crushing remark

• an electric circuit that cuts off a receiver when the signal becomes weaker than the noise

verb

• suppress or crush completely

• make a sucking sound

• walk through mud or mire

• to compress with violence, out of natural shape or condition

chequering10
25 verb, nounv, n
noun

• one of the flat round pieces used in playing the game of checkers

verb

• mark into squares or draw squares on; draw crossed lines on

• variegate with different colors, shades, or patterns

pinchbecks10
25 nounn
noun

• an alloy of copper and zinc that is used in cheap jewelry to imitate gold

adjective satellite

• serving as an imitation or substitute

ethicizing10
25 verb, adjectivev, adj
verb

• To make ethical.

exchanging10
24 verbv
noun

• chemical process in which one atom or ion or group changes places with another

• a mutual expression of views (especially an unpleasant one)

• the act of changing one thing for another thing

• the act of giving something in return for something received

• a workplace that serves as a telecommunications facility where lines from telephones can be connected together to permit communication

• a workplace for buying and selling; open only to members

• (sports) an unbroken sequence of several successive strokes

• reciprocal transfer of equivalent sums of money (especially the currencies of different countries)

• the act of putting one thing or person in the place of another:

• (chess) gaining (or losing) a rook in return for a knight or bishop

• (chess) the capture by both players (usually on consecutive moves) of pieces of equal value

verb

• give to, and receive from, one another

• exchange or replace with another, usually of the same kind or category

• change over, change around, as to a new order or sequence

• hand over one and receive another, approximately equivalent

• put in the place of another; switch seemingly equivalent items

• exchange a penalty for a less severe one

or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 10 Letter Words

Words (576)
chatteringscreechingmechanicalmicrophonehomecomingstretchingtechniciancheckpointcensorshipchandelierenchantingexchanginganestheticchimpanzeerhinoceroswinchesterphotogenicchroniclesbewitchingschedulingincoherentstrychninechannelingbutcheringchickenpoxlancashirerechargingenrichmentdictaphonechiffonademechanizedunhygienicchroniclerchangelinghedonisticthickeninganthracitetechnetiumcephalexinfianchettotelephonicmechanisedethnicallysaccharinecrochetingxenophobicschliemannphoenicianbitchinessfranchisedmetternichpathogenichypersonichypertonicnecrophilebalanchinechanceriesclomiphenefetchinglydehiscencepinchpennythermionicdeaconshipunathleticchillinessrechristenclothespinchlorinatebeseechingunstitchedchannelizecheekinessepentheticchasteninginchoativeantitheticchoicenessdisenchantchoppinesstetchinesschloraminechubbinesstouchinesschumminessethnologicnonethnicshenpeckingchancinessunclincheschagrinnedselachianschinwaggedhypermanicchunteringreteachingchainwheelfletchingstouchlinesmachinatedgynarchieschairwomenmischannelchieftainspatchinessrepatchingcharteringenchainingcherishinghandpickedtechniquespitchwomenstenchiestenchiridiahindranceschronicledmechanismsmechanistssandwichedmechanizessandwichesencipheredshanachiesschleppingraunchiestantichoicebeclothingkitchenetshesitancesbranchiestendolithicmegaphonicchitteringcinchoninecachinnateanchoritesmonarchieschamferingcochairmenbackhoeinghatchelingretouchingsquelchingcheloniansachinessescathepsinschinawareschampionedsyntheticschristenedunachievedinterchainintrenchedratchetinginherencestheophanicfranchiserintrenchesnaphthenicnonethicalcrunchiestfranchisesecheloningeunuchismssennachiesescheatingpicholineseunuchoidschafferingechinaceasunclinchednephroticshaciendadoheliclinesendotheciachemokinesbreechingssnatchiestheliconiasnaumachiaechintziestnaumachieschickeningcheapeningchopperinglunchtimesimpeachingscrunchiesachondriteprinceshipcockneyishchicnessesphonematicchainsawedepicanthuschipperingcharmingerendarchiesrevanchismhackneyingrevanchistthickenersmachinableoutchiddencashieringmachinatesreclothingchairmanedcandlefishchatelainemischancesechinodermcheckeringhaloclinesinchoatelychequeringwhickeringtechnicalsvoucheringantiheroicsphincterscheckreinscinephileschiffonierhyperpneicpinchbecksdebauchingmyasthenicgreenfinchxenolithicvetchlingsbechalkingenchiladashawfinchesbechancingchronaxiesaitchboneshelminthicbecharminghemocyaninmechanizerphenacetinenciphererenharmonicpronephricneophiliacnomotheticchirurgeoncolchicinecheerinesspaunchiestunteachingrematchingchisellingdebouchingcatarrhinecoinheringshankpiecearchegoniaphenotypicrechangingmanchineelantechoirsrancheriaschatelainsbranchlinechapteringrainchecksrechartingchamberingschmearingchiltepinsrichnessesichneumonsschmeeringunenrichedtrichinizerecheckingcheesinesschattinessunemphaticeuthanasicarchfiendsichnolitesisochroneschowderingnomarchiesendophytichoactzinesrechoosingnephelinicethicizingphenacainephenacitescochinealsanthelicestrichogynehurricaneschelationsnightscopeschnitzelsoutechoingcathectingbronchiolechondritesthylacinesunstitchesupreachingchinchiestfranchiseehematinicschinaberryindrenchedintrenchereunuchisedindrencheseunuchiseshypnogenicdinarchieslichenaleseunuchizeduncleshipschannelisecenotaphicscreichingeunuchizesacheronianacherontiapentastichchelonidaescreighingurosthenicacheronticechidninesphylogenicchlorinisechunderingchlorinizeouananicheprincehoodchunkinesschainbrakenecrophilsnecrophilyscrunchierchunneringentophyticrhyniaceaescheminglyspheniscuspythogenicchainplatesiphunclesduchessinggenethliacepicanthicdrenchingschain-smokecinchonisenochellingscherzandiconchiglieappeachingmenarchialschiavoneshackneyismhibernaclescriechingcinchonizechippinesscheatinglychairbornebotchinesshigh-neckedencephalichecogeninshigh-octanenavarchiesencephalinphoneticalpeacherinounsmirchedmachinegunchinese-redchieflingsmachinemanmischancedpeachinessmachinementescheniteorthocainerecatchingcasingheadechinoideaneogothicsmischanterpitchbendstechnicisechokepointenphytoticheroicnessparochineshectoringstechnicismtechnicistascolichentechnicizebleachingsnipcheesespitchinessalcheringaunmechanicencharginghistogenictechnikonsauthigenicchironomerencharmingmaconochieditrocheancatchinesslichanosespitchpinesanarchisedanarchisesdisenchainorthogenicunpatheticclientshiplichenismsanarchizedunchancieranarchizeslichenistsencheeringphytogenicquenchingsshriechingyellochingheptatoniceuchlorinechippewyaneuchlorinsbronchiteswrenchingscosheringsrhinocerotmechanisergleicheniamechanisessceliphronchalkinesschiromancecoachlinescoyishnesspreachingseponychiumunperchingphrenesiaccipheringschirpinesscheeringlyuncheckingphreneticsdocentshiptyphogenichaemoconiarhinothecageotechnicenhydriticcushionetschestinesskitchendomcarthamineeichhorniakitchenerschitarronesubphrenicdisbencheddisbenchesunthematicperiphonicerythrocinkitcheningmetchnikovbunchinessthinkpiecebranchlikephrensicalenclothingrancheriesnectar-richunchristenunphoneticseannachierhinoscoperhizogenichexactinalhaematinicecphonesispoachinesscetorhinustrichiniseanchoretichercynitesrecheatingtachinidaelancetfisheightpencechevisancetheodiceankitschnesssynarchiesnartheciumhygienicalempeachingtrichinoseatchievingcornetfishmonarchiseethicisingreichsteineuharmoniceuphonicalhieromancypenny-pinchmonarchizeneurochipsachaeniumsnovicehooduncipheredupcheeringgonorrheicnoviceshippunchinesscraunchiernightpiecenephologicpitchstonechevrotainethnicismschimneypotchimneyingwanchanciehemicranianephralgicfleechingsunheroicalhinderanceethnocidesmanichaeanchuffinessanthericumethnogenicbranchiategeocachingchaenactischauntriesphlegmonictheomaniacsnitchiestphagedenicchaenopsistheomanticlepechiniaschalsteincanachiteschemickingfianchettichristenernephriticshabitaunceskriechingasthenopicparischaneunderpitchschappeing
Phrases (61)
slim chancechicken runthink twicerich personclothes pintent stitchcane blightfair chancedrenched inchorus linesedan chairget in touchcanoe birchmachine guncatherine ihoney crispfire trenchchain emailchinese elmchicken legpipe wrenchchicken outconfer withchain storethink piecequince bushsun pitcherchinese yamloch linnhewar machinemexican hatslit trenchzebra finchhouse finchswitch canemunich beercharge unitbing cherryscotch pinein the lurchgiant perchsquare inchpaper chainfrench kisschilean nutdouble chinlancet fishcheese rindrein orchidice machinerein orchisbeacon hillbranch linechewing gumchewing outkahane chaiethnic jokekate chopinethnic slurchina asterchina stone
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen