Words Starting S & Ending AN
There are 334 words,
82 phrases and
0 abbr's starting with
'S' and ending with
'AN'.
Best Scoring
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| showman | 7 | 15 | nounn | |||||
noun • a person skilled at making effective presentations • a sponsor who books and stages public entertainments | ||||||||
| skyman | 6 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| sockman | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| shipman | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| shopman | 7 | 14 | nounn | |||||
noun • The proprietor, manager or operator of a small store. | ||||||||
| swagman | 7 | 13 | nounn | |||||
noun • an itinerant Australian laborer who carries his personal belongings in a bundle as he travels around in search of work | ||||||||
| sokeman | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| sextan | 6 | 13 | adverb, noun, adjectiveadv, n, adj | |||||
Valid word for Scrabble US
| ||||||||
| snowman | 7 | 12 | nounn | |||||
noun • a figure of a person made of packed snow | ||||||||
| soybean | 7 | 12 | nounn | |||||
noun • a source of oil; used for forage and soil improvement and as food • erect bushy hairy annual herb having trifoliate leaves and purple to pink flowers; extensively cultivated for food and forage and soil improvement but especially for its nutritious oil-rich seeds; native to Asia • the most highly proteinaceous vegetable known; the fruit of the soybean plant is used in a variety of foods and as fodder (especially as a replacement for animal protein) | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
sanWords (50)
shermanserbiansnowmanspartansichuansandmansoybeanshowmanshipmansaharanshaitansaurianstygiansidemansaroyansporransheitanseedmansaffiansaltpanstewpansubclansierranshopmanswagmansalpiansokemanswanpanspeleanshebeansubdeansagamansurfmanslurbansockman
...View all with 7 letters...
Phrases (3)
solo mansan juansoda canWords (67)
supermansalesmansullivansuburbansiciliansiberiansheridansumerianspacemanscotsmansaucepansoundmanszechwanspearmansubhumansomalianstockmanscythiansilurianswordmanszechuansteinmansonarmansumatransirenianspelaeansuperfanshadchanshadkhansheepmanstickmanseedsmanscalepanshwanpansyrphian
...View all with 8 letters...
Phrases (8)
soja beansoya beanstunt mansnap beanstraw mansex organspray cansquaw manWords (53)
spidermanspokesmanselectmanswordsmansamaritansportsmanslovenianscotchmanstatesmansectariansteersmansacristanslovakianstrongmansignalmansardiniansisypheansalvarsanstablemanschoolmanselachiansemiurbansuctoriansuffraganscrewbeansteradiansporozoanspleuchansalarymansafetymanswitchmanshantymanspoilsmanstrontianseptarian
...View all with 9 letters...
Phrases (10)
sri lankansports fanshah jahansieva beansnail beanscrew beanshell beansun yixiansaint joansword beanWords (35)
superhumansaleswomansuperwomanservicemanshenaniganseminariansubclaviansalvadoranscrubwomanstentoriansupercleanstuntwomansanitarianscyphozoansenatorianshahaptiansalpingiansolitarianscarabaeansymmetrianstrategiansalientianstigmarianshoshoneanshereefianshoshoniansurfacemanscintiscanshandrydanscotswomansub-saharanskinnerianspacewomansarawakiansolifidianPhrases (13)
shah of iransteam organsecret plansection manstickup mansea of japanstring beansteam cleanstunt womanservice manstan the manstewing pansense organWords (29)
singaporeanspokeswomansportswomansalvadoriansemioticiansaturnaliansaurischiansarcodiniansabbatarianspring-cleansandwichmansauropsidanstelleridansyndyasmiansertularianspinsteriansino-tibetanscincoidianscotchwomansigillarianstateswomansubartesianselectwomansagittariansubtacksmansilvestriansylvestriansynthespiansalvadoreanPhrases (6)
spic-and-spanstraight mansouth koreansporting manspeech organsweet sultanWords (19)
scandinaviansubterraneansaskatchewansexagenarianspermatozoanstatisticiansalutatorianservicewomansublibrarianstegosaurianslaughtermanstravinskianstravinskyansalamandriansaltpetremansublapsariansemeioticiansyntacticiansaudi-arabianPhrases (6)
spick-and-spansouth africansouth dakotansan sebastianstiff gentiansarah vaughanWords (13)
sesquipedaliansolitudinarianseptuagenariansabermetriciansportfishermansacramentariansupralapsarianstegocephaliansarcosporidiansauropterygiansuperterraneansarcocystideansarcocystieianPhrases (8)
south dravidianskilled workmansir henry morgansir isaac pitmansavings and loanstriped gentianspurred gentiansecretory organPhrases (1)
sir george trevelyanPhrases (1)
south american indianPhrases (1)
south-central dravidianPhrases (1)
sir george otto trevelyanPhrases (1)
sarvepalli radhakrishnanPhrases (1)
sir terence mervyn rattiganPhrases (1)
sir sarvepalli radhakrishnan
