Words Containing: Y,R,N,E
(In Any Order)
There are 5,545 words,
5,290 phrases and
0 abbr's with
Y,R,N,E in.
Best Scoring Words With: Y,R,N,E
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
frenzy | 6 | 21 | nounn | |||||
noun • state of violent mental agitation | ||||||||
enquiry | 7 | 19 | nounn | |||||
noun • an instance of questioning • a search for knowledge • a systematic investigation of a matter of public interest | ||||||||
jurymen | 7 | 19 | nounn | |||||
noun • someone who serves (or waits to be called to serve) on a jury | ||||||||
wryneck | 7 | 19 | nounn | |||||
noun • an unnatural condition in which the head leans to one side because the neck muscles on that side are contracted • Old World woodpecker with a peculiar habit of twisting the neck | ||||||||
journey | 7 | 17 | nounn | |||||
noun • the act of traveling from one place to another verb • undertake a journey or trip • travel upon or across | ||||||||
knavery | 7 | 17 | nounn | |||||
noun • lack of honesty; acts of lying or cheating or stealing | ||||||||
joinery | 7 | 17 | nounn | |||||
noun • fine woodwork done by a joiner • the craft of a joiner | ||||||||
enjoyer | 7 | 17 | nounn | |||||
noun • a person who delights in having or using or experiencing something | ||||||||
anorexy | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
reenjoy | 7 | 17 | verbv | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
renyWords (173)
anymorecenturyjourneyyoungergermanynurseryscenerysyringeurgencyrelyingenquirysensorylarcenynunneryentropyprogenysynergyregencymynheergunnerycannerybeanerynureyevyonkersreentrytourneydrynesstanneryreynardencryptplenarycryogenorangeysternlyreunify
...View all with 7 letters...
Phrases (10)
early ongrey henhen yardkey ringgray henhenry iihenry ivnew yearnew yorkhenry viWords (330)
everyoneanywhererecentlyfriendlyattorneyceremonyentirelyeternitysyndromecurrencyreynoldsurgentlyhydrogenunderwayvineyardyearningmonetaryserenitycylinderseminaryaneurysmweaponrysyringesancestrycoventrytenderlyeyelinerrefineryentiretygreeneryconveyorpyreneesmannerlygreenwayferryman
...View all with 8 letters...
Phrases (23)
mary janeby natureminor keydry cleanzane greysentry gor. h. tawneyin theoryfern allyrope yarn
...View all with 8 letters...
Words (519)
boyfriendcertainlynecessaryemergencycurrentlygenerallypregnancylegendaryfrequencysincerelyintegritystrangelysecondarycertaintymonasterymachineryinventorysinceritymaternityeternallynervouslymccartneypresentlyrecyclingyoungstermercenaryplanetaryresidencyitinerarycranberrypaternityclergymangreyhoundroutinelydysentery
...View all with 9 letters...
Phrases (63)
boy wondertroy ounceshy persongin rickeyhue and cryjohnny rebnew jerseywonder boyreturn keyhenry clay
...View all with 9 letters...
Words (742)
everythinguniversityapparentlypersonallyincrediblyterrifyingscreenplayelementaryfrequentlygenerosityfraternitymontgomerypresidencyenormouslycommentaryreasonablyinsecurityunderlyinginternallyveterinarygenerouslyindirectlyinherentlystationeryyoungberryunfriendlyterminallyencryptionunderstudyincendiaryredundancycanterburyneutralityhieronymusinsurgency
...View all with 10 letters...
Phrases (138)
epoxy resinbrya ebenusbrandy noseenergy unithoney eateryemeni rialready moneybaby minderkey patternsmart money
...View all with 10 letters...
Words (845)
anniversarypersonalitydifferentlynecessarilydocumentaryfortunatelycountrysideunnecessarypreliminarypermanentlywonderfullycontroversyuncertaintydaydreamingsovereigntydangerouslymomentarilybeneficiaryreactionarydehydrationinferiorityreluctantlyterminologyuniversallysynchronizesynthesizerrudimentarydiscrepancyconfederacyresponsiblyincorrectlyaerodynamicexplanatoryinfertilitydeuteronomy
...View all with 11 letters...
Phrases (215)
body servantelinor wyliegenus styraxbulb syringeenergy levelroentgen rayhoney badgerspiny puffersensory hairsingle entry
...View all with 11 letters...
Words (784)
increasinglycontemporaryevolutionarypenitentiaryconservatoryconsiderablysynchronizedtremendouslystorytellingrelentlesslyintermediarytransparencyaerodynamicshypertensionclytemnestraneurosurgeryelectrifyingpresbyterianincoherentlypersistentlyrefreshinglyunilaterallyhypertensivetrigonometrypyrotechnicsclairvoyanceeccentricityinextricablysynchroniseddiversionaryhypnotherapyconcurrentlyoceanographyterrifyinglyforensically
...View all with 12 letters...
Phrases (280)
mary magdalenmrs. henry woodstaying powerhorn of plentyrandom memoryread-only fileearnest moneygenus syringaacrylic resinhoneyed words
...View all with 12 letters...
Words (684)
unfortunatelyextraordinaryrevolutionaryunnecessarilyvulnerabilityinterestinglycomplimentaryparliamentaryinadvertentlychrysanthemumprecautionarypredominantlyfrighteninglycomplementaryalternativelysupplementarynitroglycerineverlastinglyirresponsiblydiscretionaryexpeditionarynorthwesterlyoveranalyzingconfectioneryintravenouslyindifferentlydehydrogenaseinterlocutorydistressinglypreliminarilyneurosyphilisenergeticallyconfectionaryextravagantlypredominately
...View all with 13 letters...
Phrases (368)
harvey cushingel iskandriyahvaginal arterydirect antonymauditory sensenursery schoolinventory itembrandy snifterarnold toynbeespiny anteater
...View all with 13 letters...
Words (519)
responsibilityprofessionallycinematographyunderstandablyelectronicallyoverwhelminglyhypersensitiveinterplanetaryundersecretarypancreatectomythermodynamicshyperventilatenitroglycerineexcruciatinglyintermittentlyconservativelypsychoneuroticsupernaturallyembarrassinglyexperimentallygeosynchronousnephrotoxicitynarcosynthesisgovernmentallyconstructivelyconvertibilityunsynchronizedinheritabilityinconsiderablypolymerizationintermediatelyentertaininglydifferentiallyhydropneumaticendarterectomy
...View all with 14 letters...
Phrases (402)
anthony burgesstubal pregnancydrunken revelryveliky novgorodyellowish brownnavy departmentemergency brakecanterbury belldrainage systemabstract entity
...View all with 14 letters...
Words (397)
extraordinarilyinternationallyenvironmentallyinappropriatelysynergisticallyoversimplifyingparentheticallyplenipotentiaryaerodynamicallyproportionatelymaneuverabilityinstrumentalityinvulnerabilitycontroversiallyneurophysiologyuncomplimentaryrecrystallizingencephalographyintrospectivelyunparliamentaryuninterruptedlypolyunsaturateddemonstrativelycorrespondinglyunceremoniouslyheartbreakinglyunprecedentedlyinconsideratelyneuropsychiatrycomprehensivelytemperamentallydiphenhydramineinterdependencyinterrogativelysymmetricalness
...View all with 15 letters...
Phrases (472)
centaurea cyanusbenefit of clergyalimentary pasteebony spleenwortmail-order buyingby trial and errorlycosa tarentulahyoscyamus nigersolemnity of marystonecrop family
...View all with 15 letters...
Words (165)
indiscriminatelyirresponsibilityincomprehensiblytriphenylmethanehyperintelligentunpredictabilityhyperventilationnonrevolutionarysphygmomanometerextemporaneouslyincontrovertiblythrombocytopeniadendrochronologyhypersensitivityunprofessionallyconversationallyneuropsychiatrichypersalivationsheterokontophytaparamagneticallytrinitroglycerincommensurabilityhypersensitizinghypersomnolenceshyperstimulatinghyperstimulationadministrativelyapocryphalnesseshyperventilatinghypervitaminosessphygmomanometrythrombocytopenicglossopharyngealindiscernibilityarchaeoastronomy
...View all with 16 letters...
Phrases (478)
hypodermic needletympanic membranein a beastly manneritalian greyhoundstrictly speakingchristian huygensfamily cyprinidaein an elaborate wayefficiency expertgenus crotaphytus
...View all with 16 letters...
Words (117)
counterinsurgencysuperconductivityperchloroethyleneneurophysiologistcontemporaneouslythermodynamicallyinterdisciplinaryantirevolutionaryself-contradictoryisoelectronicallypolymorphonuclearhyperstimulationshyperventilationsnonprofessionallysphygmomanometersthrombocytopeniaschlortetracyclinepaternalisticallyarchitectonicallyferrimagneticallymorphogeneticallyunderstandabilitycryopreservationscryptocrystallinelaryngopharyngealpentylenetetrazolpostrevolutionarymicropaleontologyhyperalimentationgastroenterostomycounterfactualitymacroevolutionaryuncontroversiallyrecrystallizationtrichloroethylene
...View all with 17 letters...
Phrases (481)
dame margot fonteynmary leontyne priceczech monetary unitproteolytic enzymemary mcleod bethunecuban monetary unitinterstate highwaypearly everlastinglycopus americanuscylinder separator
...View all with 17 letters...
Words (77)
disproportionatelyhyperaldosteronisminterchangeabilityneuropsychologicalhypersensitivenesspolyesterificationmethyltestosteronehypersensitivitieshypersensitizationpolymorphonuclearselectrodynamometerpolyribonucleotidenoncomprehensivelysphygmomanometriespentylenetetrazolsanthropocentricitycylindrical-stemmedperchloroethylenestriphosphopyridinelymphangiographieshyperbilirubinemiadiethylmalonylurearecrystallizationscounterintuitivelymagnetostrictivelygeochronologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenesgranulocytopoiesesgranulocytopoiesispolypropenonitrileaerothermodynamics
...View all with 18 letters...
Phrases (446)
bombycilla cedrorunworldly possessionsrevolutionary groupadministrative bodydame sybil thorndikeeriobotrya japonicalachrymal secretionfreudian psychologygenus styracosaurusafghan monetary unit
...View all with 18 letters...
Words (52)
cinematographicallypolyesterificationshypersensitizationsextralinguisticallypolyribonucleotideshypolipoproteinemiaparthenogeneticallynonrelativisticallycytodifferentiationimmunocytochemistrymagnetohydrodynamicphenylthiocarbamideechoencephalographydehydrochlorinatingdehydrochlorinationmercury-contaminatedelectrodynamometersinterconvertibilityphosphoenolpyruvateinterdepartmentallyelectromagneticallycontradistinctivelyelectromechanicallythird-dimensionalityinterferometricallyhysterosalpingogramthree-dimensionalityimpressionisticallymethylcholanthrenesmethylprednisolonesdeoxyribonucleotideanthropocentricallyelectroretinographyincomprehensibilitymicroelectronically
...View all with 19 letters...
Phrases (385)
water-plantain familyseventeen-year locustitalian monetary unithydrastis canadensislatvian monetary unitalpine type of glaciergiles lytton stracheyphytolacca americanazairese monetary unitgenus cryptobranchus
...View all with 19 letters...
Words (29)
counterrevolutionaryuncharacteristicallyoverenthusiasticallytetrahydrocannabinolhypersensitivenessespolyphiloprogenitiveradioimmunoassayablehyperadrenocorticismcytodifferentiationslymphogranulomatosesphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiamagnetohydrodynamicsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryroentgenographicallyencephalomyocarditispseudoparenchymatoussyncategorematicallyhyperconsciousnessesdimethylnitrosaminesPhrases (331)
honduran monetary unitmalawian monetary unitlebanese monetary unitbalaenoptera physalusdivision tracheophytahundred-and-forty-fifthbyelorussian languagebenjamin henry latrobeuniversity of nebraskamilton snavely hershey
...View all with 20 letters...
Words (8)
immunocytochemistriesacetylcholinesterasesotorhinolaryngologiesdendrochronologicallypolyvinyl-formaldehydeintersubstitutabilityantiferromagneticallytetrahydrocannabinolsPhrases (243)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsynmalaysian monetary unitbulgarian monetary unitdesoxyribonucleic acidhungarian monetary unitsri lankan monetary unitextrauterine pregnancybyzantine architecture
...View all with 21 letters...
Words (6)
pentamethylenetetrazolintercomprehensibilityelectroencephalographyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (212)
venezuelan monetary unitlycopersicon esculentumredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer forcehigh-density lipoprotein
...View all with 22 letters...
Words (3)
polytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (160)
family threskiornithidaegeorge macaulay trevelyanposterior pituitary glandmeperidine hydrochlorideyellowstone national parkkazakhstani monetary unitparis-sorbonne universityinterlocutory injunctioneuropean recovery programkyrgyzstani monetary unit
...View all with 23 letters...
Words (2)
laryngotracheobronchitishyperbetalipoproteinemiaPhrases (120)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwinprivately held corporationzollinger-ellison syndromesir terence mervyn rattigandistinguished flying crossalexandre emile jean yersin
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (95)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraemary wollstonecraft shelleydiamond wedding anniversaryfrancis scott key fitzgeraldcentral intelligence agencypropoxyphene hydrochloridemelanerpes erythrocephalusreligious society of friendsbeggar-my-neighbour strategy
...View all with 25 letters...
Phrases (69)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytina
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (58)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelaugustus welby northmore puginco-operative republic of guyanacommissioned military officer
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (47)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngercardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitymaster of arts in library science
...View all with 28 letters...
Phrases (31)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systemedward george earle bulwer-lyttoninternational olympic committee
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (28)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (18)
great smoky mountains national parkfreedom from involuntary servitude2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusport-access coronary bypass surgeryrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armont
...View all with 31 letters...
Phrases (23)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovnonsteroidal anti-inflammatory druguniversity of california at berkeleytheory of electrolytic dissociationoculopharyngeal muscular dystrophy
...View all with 32 letters...
Phrases (15)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapy
...View all with 33 letters...
Phrases (11)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricuserasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitygymnosporangium juniperi-virginianaecomputerized axial tomography scanner
...View all with 34 letters...
Phrases (12)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin maryhereditary motor and sensory neuropathynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrima
...View all with 35 letters...
Phrases (9)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (13)
severe combined immunodeficiency diseaseuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausendefense advanced research projects agency
...View all with 37 letters...