Words Containing: Y,L,I,K,E
(In Any Order)
There are 245 words,
392 phrases and
0 abbr's with
Y,L,I,K,E in.
Best Scoring Words With: Y,L,I,K,E
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
kylikes | 7 | 18 | nounn | |||||
noun • An Ancient Greek drinking cup with a stem, two handles, and a broad, shallow body | ||||||||
skylike | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
ivylike | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
lekythi | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
perkily | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a perky manner | ||||||||
peskily | 7 | 16 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
beyliks | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
beylik | 6 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
skyline | 7 | 14 | nounn | |||||
noun • the outline of objects seen against the sky • the line at which the sky and Earth appear to meet | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (33)
unlikelymckinleyladylikevalkyriewickedlybiweeklysneakilykilobytecheekilyhymnlikeskylinesfreakilyquaylikekielbasyrubylikewheylikecreakilyflickerywalkyrieyokelishlilylikekryoliteclaylikeyolkiesteyeblinksickerlylekythoiplaylikekeylinesbaby-likekyriellelynxlikecity-likePhrases (3)
eye blinkmilk wheysilky elmWords (47)
kimberleyjellylikehyperlinkpuppylikesylphlikeberrylikefairylikesyruplikeirksomelywalkyriesweakishlylackeyingkilocyclejerkinglysketchilystreakilyivorylikeharpylikekilobytesyeastlikemanlikelykryoliteseyeblinkspalsyliketriweeklyputtylikevalkyriesbellylikesqueakilysatyrlikepeckishlymidweeklyscreakilykvetchilyhoneylike
...View all with 9 letters...
Phrases (3)
like crazymilk yieldrelay linkWords (32)
mistakenlybricklayerfreakishlylawyerlikeunladylikeskylightedsneakinglyhyperlinksleukocyticperikaryallymphokinekilocyclessemiweeklycherrylikekindlesslykidneylikescythelikesneakishlyflystrikesmyxinikelaspeakinglyflunkeyishflunkeyismcreakinglypikeblennykeelyvinesstrickenlyrebukinglykallitypespokerishlykelyphiticklendusityPhrases (9)
mt. mckinleyisle of skyelady killerlickety cutalkyd resinriley b kingflorida keysleepy dicklion monkeyWords (34)
yellowknifehypokalemiahypokalemickinesiologysickeninglyskepticallytalkativelyhyperlinkedflyspeckingbricklayerschimneylikealkalimetrylymphokinesfactorylikelickerishlykaryologieskittenishlykineticallychelyabinskpinnywinkleflunkeyismsshriekinglytiddleywinkmistakeablypennywinklethelytokiesfernyticklepoikilocytesqueakinglybialystokersilky-hairedsilky-leafedsilky-leavedtiggywinklePhrases (25)
louis leakeylike royaltybilly the kidpolicy makeralkyl halideclosely knitcelery stickannie oakleyfield hockeybicycle rack
...View all with 11 letters...
Words (27)
hyperkalemiaholidaymakerhyperlinkingflickeringlyleukocytosisdaydreamlikekremlinologyhypokalemiaspinnywinklesrevokabilityfairnytickleleukocytoticblackish-greycockyleekiesgreyish-blacktiddledywinktiddleywinkspennywinklesladylikenessfernyticklespoikilocyteshydraulickedbreakabilitylocksmitherytiggywinklesquicksilverykeratohyalinPhrases (19)
lickety splithockey clinicblink of an eyealfred kinseytake kindly toliterary workcylinder lockvery much likeslippery dickmercy killing
...View all with 12 letters...
Words (17)
marketabilityholidaymakerstiddledywinkskindheartedlykinematicallyblackberryingfairnyticklesclickety-clackclickety-clickjawbreakinglyremarkabilityunmistakeablypoikilothermysketchabilityforeknowinglyprickly-leafedprickly-leavedPhrases (23)
el iskandriyahmount mckinleyrichard leakeywhiskey bottlesilky wisteriakillarney fernboykinia elatayellowish pinkcylinder blockblended whisky
...View all with 13 letters...
Words (11)
breathtakinglyearthshakinglyhydrokineticalleukocytosisesblackberry-lilyblackberryingsvelvety-skinnedhuckleberryingyekaterinoslavladylikenessesdiphenylketonePhrases (36)
dimethyl ketoneveliky novgorodcapital of kenyablended whiskeyemily dickinsonkyrgyz republicbishop berkeleysleepy sicknessfamily akeridaestanley kubrick
...View all with 14 letters...
Words (12)
heartbreakinglykinestheticallyankylostomiasesphenylketonuriccholecystokinintelekineticallyphenylketonuriaknowledgabilitykenogeneticallylymphoblast-likehuckleberryingsdiphenylketonesPhrases (31)
capital of turkeyalfred korzybskisecurity blanketwilliam mckinleymarketable yieldwilliam shockleygenus myxinikelafield hockey ballhydraulic brakesfamily triakidae
...View all with 15 letters...
Words (6)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricscholecystokininsknowledgeabilityPhrases (27)
strictly speakingcapital of new yorkfriendly takeoverfamily gekkonidaeelwyn brooks whiteyellowfin croakerkerry blue terrierproperly speakingradial keratotomybenjamin kubelsky
...View all with 16 letters...
Phrases (10)
holy roman emperor frederick iialeksandr sergeyevich pushkinfalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventorymartin luther king jr's birthdaykepler's law of planetary motionPhrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay