Words Containing: Y,L,I,E
(In Any Order)
There are 7,719 words,
5,506 phrases and
0 abbr's with
Y,L,I,E in.
Best Scoring Words With: Y,L,I,E
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| cyclize | 7 | 23 | verbv | |||||
verb • To undergo, or cause to undergo, a reaction resulting in the formation of an aromatic or ring structure. | ||||||||
| liquefy | 7 | 22 | verbv | |||||
verb • become liquid • make (a solid substance) liquid, as by heating • become liquid or fluid when heated | ||||||||
| hexylic | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| fixedly | 7 | 21 | adverbadv | |||||
adverb • in a fixed manner | ||||||||
| cliquey | 7 | 21 | adjectiveadj | |||||
adjective • Having the characteristics of a clique | ||||||||
| jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
| dialyze | 7 | 20 | verbv | |||||
verb • separate by dialysis | ||||||||
| mixedly | 7 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| jellify | 7 | 20 | verbv | |||||
verb • become jelly • make into jelly | ||||||||
| vixenly | 7 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (195)
realityyellingquietlyheavilylibertybicyclebrieflysnidelyrelyingfireflymerrilyreadilyyelpingideallyskylineliquefysilveryweirdlyyisraelelysianmiserlychieflypaisleynaivelyelysiummyeloidlevyinginanelybelyingwearilydiddleywhitelydevilryglycinefixedly
...View all with 7 letters...
Phrases (8)
sea lilyin styleslide bywild ryeevil eyekey limeyield upglide byWords (451)
directlyfriendlydeliveryentirelyterriblyunlikelyslipperysilentlyliteraryideologypolitelyequalityvelocityepilepsycylinderdelicacyfidelityfelicitysteadilyfiercelyplaytimeactivelyinsanelyuniquelybitterlycelibacymckinleyeyelinerheartilytricycleyodelinguntimelypriestlyliteracydyslexic
...View all with 8 letters...
Phrases (21)
egg yieldlive bodyeye blinkfile awaymilk wheyhoney oildevil rayyard linepine lilylife buoy
...View all with 8 letters...
Words (645)
seriouslycertainlyliterallypreciselycelebrityspeciallylifestylespecialtysincerelysexualityartilleryillegallyprivatelyevidentlymentalitygenuinelyseeminglyhairstylefertilityviolentlyjellyfishrecyclingfairytaledisplayedpatientlyintenselyimmenselyberylliummedicallymiserablylongevityaimlesslyroutinelymassivelyexcitedly
...View all with 9 letters...
Phrases (62)
high stylelike crazyegg layingbenny hillhair stylelife storyivy leaguewhile awaymilk yieldold bailey
...View all with 9 letters...
Words (854)
definitelyespeciallyincrediblypreviouslyultimatelyhystericalrelativelypositivelydisneylandinevitablyspecialitycomplexityinfidelityunderlyingdiscreetlyrelativityinfinitelyinternallyintimatelyindirectlysensualityinherentlyverticallydisorderlychemicallymistakenlyunfriendlyadmittedlyterminallyexplicitlynegativelystealthilydelicatelybricklayercreatively
...View all with 10 letters...
Phrases (106)
line of dutyfamily linemt. mckinleyfield pansyrift valleyaniline dyeyemeni rialgrey willowpineal bodyisle of skye
...View all with 10 letters...
Words (1156)
immediatelyelectricitypersonalitydifferentlynecessarilytechnicallyessentiallybeautifullyemotionallytemporarilypreliminarypotentiallycredibilitygeneticallyeffectivelyexclusivelymomentarilyflexibilitysymmetricalmercilesslyexceedinglyexcessivelyefficientlypsychedelicobjectivelysensibilityterminologyuniversallyincessantlydelinquencyconfidentlyextensivelyreligiouslyresponsiblyreliability
...View all with 11 letters...
Phrases (185)
laying wastelouis leakeysilver berryelinor wyliebulb syringesingle entryplaying areaspecial jurydry cleaningfilthy lucre
...View all with 11 letters...
Words (1190)
specificallyaccidentallydeliberatelyincreasinglypennsylvaniaincidentallyunbelievablyevolutionaryindefinitelypassionatelysufficientlymysteriouslyconsiderablygynecologistencyclopediaconsistentlyhypotheticalaggressivelyeconomicallydefinitivelycollectivelyconvenientlymetaphysicalstorytellinghystericallyperiodicallymeticulouslytechnicalityfigurativelycommerciallytriglyceridedelightfullypatheticallyinexplicablyconclusively
...View all with 12 letters...
Phrases (242)
molly pitchergenus glycinelickety splitwilliam wyleradmiral deweyread-only filehockey clinicsquirrel awaymyrtle familyathletic type
...View all with 12 letters...
Words (1115)
revolutionaryapproximatelyunnecessarilyintentionallytheoreticallyhomosexualityexceptionallyindependentlyinstinctivelyvulnerabilityinterestinglyappropriatelycomplimentaryparliamentaryinadvertentlyprogressivelyhieroglyphicsgynaecologistrealisticallystrategicallypredominantlyexponentiallycategoricallyintelligentlyfrighteninglycomparativelyirretrievablymagnificentlyalternativelynitroglycerineverlastinglystereotypicalconsecutivelyideologicallyirresponsibly
...View all with 13 letters...
Phrases (326)
aleatory musicel iskandriyahfamily laridaevaginal arterygilbert murrayfamily picidaemount mckinleymyrsine familyadmiralty milefamily poaceae
...View all with 13 letters...
Words (820)
responsibilitysimultaneouslyprofessionallyscientificallyhypotheticallysystematicallyintellectuallycoincidentallymetaphoricallyaffectionatelyelectronicallydemocraticallyoverwhelminglysentimentalitymathematicallyrespectabilitygeographicallyalphabeticallyunquestionablyintentionalityinterplanetaryconfidentiallyterritorialityhyperventilatenitroglycerineexcruciatinglyintermittentlyconservativelyconventionallypredictabilityclitoridectomysusceptibilitygynaecologicalembarrassinglyexperimentally
...View all with 14 letters...
Phrases (419)
family apiaceaepearl mae baileyfield intensitymoonseed familywilliam tyndaledimethyl ketonefamily ardeidaehigh technologyveliky novgorodyellowish brown
...View all with 14 letters...
Words (602)
confidentialityextraordinarilyinternationallytechnologicallyunintentionallyinstantaneouslyenvironmentallyinappropriatelyanaesthesiologydisrespectfullyheterosexualityconscientiouslysynergisticallyinaccessibilityoversimplifyingintellectualitysurreptitiouslyparentheticallyplenipotentiarycondescendinglyaerodynamicallyproportionatelymaneuverabilitytherapeuticallyinfinitesimallyinstrumentalityinvulnerabilitycontroversiallysuccinylcholineneurophysiologycytomegaloviruscompassionatelyuncomplimentarymethylphenidaterecrystallizing
...View all with 15 letters...
Phrases (570)
auditory ossiclebenefit of clergyalimentary pasteasamiya languagehelen wills moodydialysis machinefamily tinamidaefamily lemnaceaefamily arecaceaemail-order buying
...View all with 15 letters...
Words (242)
enthusiasticallyindiscriminatelyirresponsibilityincomprehensiblytriphenylmethanehyperintelligentunpredictabilityhyperventilationquintessentiallyphylogeneticallyimperceptibilitynonrevolutionarypharmaceuticallyerythroblastosisunapologeticallythermostaticallysurrealisticallyincontrovertiblyelectrochemistryunprofessionallyinconceivabilityconversationallypolydispersitieshypersalivationsinextinguishablycolorimetricallyexterritorialitythermometricallyparamagneticallytrinitroglycerincommensurabilitynoncompetitivelyhypersexualitiespolyphyleticallyinexhaustibility
...View all with 16 letters...
Phrases (518)
hypodermic needlein a beastly manneritalian greyhoundstrictly speakingfamily cyperaceaefamily cyprinidaewilliam wycherleycardiac glycosidein an elaborate waychemical analysis
...View all with 16 letters...
Words (157)
unconventionalitybacteriologicallymaterialisticallyneurophysiologistelectrostaticallythermodynamicallyinconsequentiallysocioeconomicallyinterdisciplinaryantirevolutionaryself-contradictoryisoelectronicallycercidiphyllaceaeunexchangeabilitykaleidoscopicallyspondylolisthesishyperstimulationsspectroscopicallyhyperventilationsnonprofessionallyhypnotizabilitieschlortetracyclinemonosyllabicitiespaternalisticallypathophysiologiesarchitectonicallyferrimagneticallymorphogeneticallyunderstandabilitylexicographicallycryptocrystallineencephalomyelitiscrystallographiespostrevolutionarymicropaleontology
...View all with 17 letters...
Phrases (537)
mary leontyne pricesalvia leucophyllabalaena mysticetusproteolytic enzymehypoglycemic agentpearly everlastingfamily dasypodidaelycopus americanusmalaysian languagetheological system
...View all with 17 letters...
Words (82)
characteristicallydisproportionatelyinconsequentialityhypercoagulabilityhyperaldosteronisminterchangeabilityneuropsychologicalpolyesterificationspectroheliographypolyribonucleotidenoncomprehensivelycylindrical-stemmedlipopolysaccharidelymphangiographieshyperbilirubinemiastereospecificallyimmunocytochemicalcalymmatobacteriumstoichiometricallydiethylmalonylurearecrystallizationsdiethylstilbestrolcounterintuitivelymucopolysaccharidehypercholesteremiamagnetostrictivelymyeloproliferativephenomenologicallyhydroflumethiazidegeochronologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenes
...View all with 18 letters...
Phrases (493)
bombycilla cedrorunworldly possessionsrevolutionary groupfamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologynavigational systempodilymbus podicepscolumbia university
...View all with 18 letters...
Words (66)
hydrochlorothiazidecinematographicallypolyesterificationsextralinguisticallypolyribonucleotidesextraterritorialityhypersusceptibilityhypolipoproteinemiaparthenogeneticallynonrelativisticallymucopolysaccharideslipopolysaccharidesconceptualisticallydiethylstilbesteroldiethylstilboestrolbacteriochlorophyllphenomenalisticallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholineinterconvertibilityinterdepartmentallyelectromagneticallycontradistinctivelyelectromechanicallythird-dimensionalityinterferometricallyhysterosalpingogramthree-dimensionalityimpressionisticallyelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologist
...View all with 19 letters...
Phrases (451)
building supply housewater-plantain familyacetylsalicylic acidfamily cyclopteridaejohn millington syngefamily cynoglossidaeitalian monetary unitlatvian monetary unitmillimeter of mercuryalpine type of glacier
...View all with 19 letters...
Words (35)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolpolyphiloprogenitiveradioimmunoassayableimmunocytochemicallymagnetofluiddynamicsbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesroentgenographicallyencephalomyocarditischemotherapeuticallyhydrochlorothiazidespsychopharmacologiesmicrophotometricallysyncategorematicallyhypercholesterolemichypercoagulabilitiesdimethylnitrosaminesplethysmographicallyexistentialisticallyPhrases (377)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesfamily trachipteridaebalance sheet analysis
...View all with 20 letters...
Words (13)
hypogammaglobulinemiahypersusceptibilitiesstereomicroscopicallyacetylcholinesterasesotorhinolaryngologieselectromyographicallydendrochronologicallypolyvinyl-formaldehydeintersubstitutabilityantiferromagneticallyhypercholesterolemiaspsychotherapeuticallytetrahydrocannabinolsPhrases (272)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitdesoxyribonucleic acidsri lankan monetary uniteucalyptus fraxinoidescynoglossum officinale
...View all with 21 letters...
Words (6)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (243)
venezuelan monetary unitlycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (2)
hexamethylenetetramineshypobetalipoproteinemiaPhrases (162)
family threskiornithidaeposterior pituitary glandmeperidine hydrochlorideyellowstone national parkcalycanthus occidentalisinterlocutory injunctionbangladeshi monetary unitdorothy rothschild parkerrichard brinsley sheridansciadopitys verticillata
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (105)
carnegie mellon universitylouis seymour bazett leakeymary wollstonecraft godwinunidentified flying objectprivately held corporationzollinger-ellison syndromebrassica oleracea botrytisdistinguished flying crossalexandre emile jean yersinapocynum androsaemifolium
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (83)
myroxylon balsamum pereiraefrancis scott key fitzgeraldcentral intelligence agencyedmund john millington syngepropoxyphene hydrochloridepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkin
...View all with 25 letters...
Phrases (60)
brassica oleracea gongylodesemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (53)
business environment analysisamerican revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commissiontricyclic antidepressant drug
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (43)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland security
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (30)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrison
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (29)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (17)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technologytupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agency
...View all with 31 letters...
Phrases (17)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (14)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (9)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (10)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committeeunited states naval research laboratoryPhrases (10)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratorykarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysixteen personality factor questionnaireunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay
