Words Containing: Y,L,E
(In Any Order)
There are 13,151 words,
7,574 phrases and
1 abbr with
Y,L,E in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
cyclize | 7 | 23 | verbv | |||||
verb • To undergo, or cause to undergo, a reaction resulting in the formation of an aromatic or ring structure. | ||||||||
liquefy | 7 | 22 | verbv | |||||
verb • become liquid • make (a solid substance) liquid, as by heating • become liquid or fluid when heated | ||||||||
hexylic | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hazelly | 7 | 22 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
mazedly | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
fixedly | 7 | 21 | adverbadv | |||||
adverb • in a fixed manner | ||||||||
cliquey | 7 | 21 | adjectiveadj | |||||
adjective • Having the characteristics of a clique | ||||||||
equably | 7 | 21 | adverbadv | |||||
adverb • in an equable manner | ||||||||
lacquey | 7 | 21 | verb, nounv, n | |||||
noun • A footman, a liveried male servant. • A fawning, servile follower. verb • To attend, wait upon, serve obsequiously. • To toady, play the flunky. | ||||||||
vexedly | 7 | 21 | ||||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (419)
reallymyselflovelyplayedlawyerplentylonelynearlyplayerlatelysurelyeasilyyellowbarelylikelydeeplyvalleynicelymerelysafelygentlydeadlyrarelysleepymelodylegacyfreelyshellyyelleddearlywesleylivelyridleysmellypurely
...View all with 6 letters...
Phrases (8)
wet flybee flyleg daylet flye layerrely onf layerlac dyeWords (677)
alreadyexactlyrealityclearlyhealthyyellingquietlyheavilypenaltystanleylibertycloselylotterybicyclejewelrygallerywealthylegallyequallydelayedelderlyutterlygreatlybradleyslaveryanalyzecrueltybrieflycharleyshelleyorderlyallergylargelysnidelyeyeball
...View all with 7 letters...
Phrases (27)
sea lilyred clayegg yolkin stylebay leaffly openhay balelay overholy joeearly on
...View all with 7 letters...
Words (1215)
yourselfsuddenlyrecentlyhonestlyproperlydirectlyfriendlydeliveryentirelyterriblyemployeesecretlymentallyassemblysexuallyheavenlyjealousyunlikelybetrayalslipperyemployedreynoldssecondlyurgentlyseverelyemployersilentlyliteraryideologypolitelyadulteryremotelyequalitysyllableanalyzed
...View all with 8 letters...
Phrases (84)
type slugold styledry cleannell gywnvery wellegg yieldbandy leglive bodyon the slyeye blink
...View all with 8 letters...
Words (1499)
seriouslycertainlyperfectlycarefullyextremelyliterallyhopefullypreciselybutterflycurrentlygenerallycelebritycorrectlyspeciallylifestylelegendaryspecialtysincerelyregularlystrangelyparalyzedsexualityartilleryillegallyprivatelyevidentlyjewellerymentalitygenuinelyseeminglyendlesslyhairstyleallegedlyfertilityeternally
...View all with 9 letters...
Phrases (195)
lake nyasaholy placehigh stylelike crazypuppy lovebog myrtlelymph cellalex haleyegg layingturkey leg
...View all with 9 letters...
Words (1702)
absolutelycompletelydefinitelyespeciallyapparentlypersonallyeventuallytechnologyincrediblymotorcyclepreviouslyultimatelyunemployedsupposedlyemploymentscreenplayhystericalelementarypeacefullyexcellencyrelativelyfrequentlyrepeatedlyseparatelymelancholypositivelyvolleyballdisneylandapocalypsepreferablypresumablyaccuratelyremarkablyenormouslyinevitably
...View all with 10 letters...
Phrases (287)
genus lyguswoody allenmary leakeyfleur-de-lysholy rollerline of dutyfamily linemt. mckinleyfield pansyrift valley
...View all with 10 letters...
Words (1840)
immediatelyelectricitypersonalitydifferentlynecessarilytechnicallyfortunatelyessentiallybeautifullydesperatelyemotionallytemporarilyundoubtedlypreliminarypotentiallypermanentlycredibilitygeneticallyeffectivelywonderfullyexclusivelyyellowstonedangerouslymomentarilyflexibilityarchaeologysymmetricalmercilesslyprematurelystorytellerexceedinglyregrettablyexcessivelyefficientlypsychedelic
...View all with 11 letters...
Phrases (372)
genus lycosalaying wastelouis leakeysilver berryelinor wyliebulb syringemary shelleyenergy levelsingle entryplaying area
...View all with 11 letters...
Words (1734)
specificallyaccidentallydeliberatelysuccessfullyunemploymentincreasinglypennsylvaniaunexpectedlyincidentallyunbelievablyevolutionaryindefinitelyrespectfullypassionatelysufficientlymysteriouslyconsiderablygynecologistencyclopediaconsistentlytremendouslyhypotheticalconsequentlyaggressivelyeconomicallysubsequentlydefinitivelycollectivelyconvenientlymetaphysicalstorytellingrelentlesslyformaldehydehystericallyperiodically
...View all with 12 letters...
Phrases (452)
mary magdalenmolly pitchergenus glycinehorn of plentylickety splitwilliam wyleradmiral deweyread-only filehockey clinicsquirrel away
...View all with 12 letters...
Words (1440)
unfortunatelyrevolutionaryapproximatelyunnecessarilyintentionallytheoreticallyhomosexualityexceptionallyfundamentallyindependentlyinstinctivelyspontaneouslyvulnerabilityinterestinglyappropriatelycomplimentaryparliamentaryinadvertentlyprogressivelyhieroglyphicsgynaecologistrealisticallystrategicallypredominantlyexponentiallycategoricallyspectacularlyintelligentlyfrighteninglycomparativelycomplementaryirretrievablymagnificentlyalternativelysupplementary
...View all with 13 letters...
Phrases (538)
aleatory musicel iskandriyahfamily laridaevaginal arteryneglect of dutysecond balconygilbert murrayfamily picidaeyakut languagemount mckinley
...View all with 13 letters...
Words (1013)
responsibilitysimultaneouslyprofessionallyscientificallyhypotheticallysystematicallyintellectuallycoincidentallymetaphoricallywholeheartedlyaffectionatelyunderstandablyelectronicallydemocraticallyoverwhelminglysentimentalitymathematicallyrespectabilitygeographicallyalphabeticallynanotechnologyunquestionablyintentionalityinterplanetaryconfidentiallyunsuccessfullyterritorialityelectrotherapyhyperventilatenitroglycerineexcruciatinglyintermittentlyconservativelyconventionallypredictability
...View all with 14 letters...
Phrases (631)
family apiaceaepearl mae baileyfield intensitybattle of nasebymoonseed familywilliam tyndaledimethyl ketonefamily ardeidaetubal pregnancydrunken revelry
...View all with 14 letters...
Words (715)
confidentialityextraordinarilyinternationallytechnologicallyunintentionallyinstantaneouslyenvironmentallyinappropriatelyanaesthesiologydisrespectfullyheterosexualityconscientiouslylymphadenopathysynergisticallyinaccessibilitydevelopmentallyoversimplifyingintellectualitysurreptitiouslyparentheticallyplenipotentiarycondescendinglyaerodynamicallyproportionatelymaneuverabilitytherapeuticallyinfinitesimallyinstrumentalityinvulnerabilitycontroversiallysuccinylcholineneurophysiologycytomegaloviruscompassionatelyuncomplimentary
...View all with 15 letters...
Phrases (737)
auditory ossiclebenefit of clergycharlotte cordayclass pelecypodaalimentary pasteasamiya languagehelen wills moodydialysis machineebony spleenwortfamily tinamidae
...View all with 15 letters...
Words (292)
enthusiasticallyindiscriminatelyirresponsibilityincomprehensiblytriphenylmethanehyperintelligentunpredictabilityhyperventilationquintessentiallyphylogeneticallyimperceptibilitynonrevolutionaryelectromyographypharmaceuticallyerythroblastosisextemporaneouslyunapologeticallythermostaticallysurrealisticallyincontrovertiblyelectrochemistrydendrochronologyunprofessionallyinconceivabilityconversationallypolydispersitieshypersalivationsinextinguishablypolyelectrolyteshymenophyllaceaecolorimetricallyexterritorialityparaformaldehydethermometricallyextracorporeally
...View all with 16 letters...
Phrases (699)
hypodermic needlein a beastly manneritalian greyhoundstrictly speakingfamily cyperaceaefamily cyprinidaewilliam wycherleycardiac glycosidein an elaborate waybluegrass country
...View all with 16 letters...
Words (176)
unconventionalitybacteriologicallyperchloroethylenematerialisticallyneurophysiologistelectrostaticallycontemporaneouslythermodynamicallyinconsequentiallysocioeconomicallyinterdisciplinaryantirevolutionaryself-contradictoryisoelectronicallycercidiphyllaceaepolymorphonuclearunexchangeabilityparaformaldehydeskaleidoscopicallyspondylolisthesishyperstimulationsspectroscopicallyhyperventilationsnonprofessionallyhypnotizabilitieschlortetracyclinemonosyllabicitiespaternalisticallypathophysiologiesarchitectonicallyferrimagneticallymorphogeneticallyunderstandabilitylexicographicallycryptocrystalline
...View all with 17 letters...
Phrases (684)
gopherus polypemusmary leontyne pricesalvia leucophyllabalaena mysticetusproteolytic enzymemary mcleod bethunehypoglycemic agentpearly everlastingclass rhodophyceaecoccygeal vertebra
...View all with 17 letters...
Words (98)
characteristicallydisproportionatelyinconsequentialityhypercoagulabilityhyperaldosteronisminterchangeabilityneuropsychologicalpolyesterificationspectrofluorometrymethyltestosteronepolymorphonuclearselectrodynamometerspectroheliographypolyribonucleotidenoncomprehensivelypentylenetetrazolscylindrical-stemmedperchloroethyleneslipopolysaccharidelymphangiographieshyperbilirubinemiastereospecificallyimmunocytochemicalcalymmatobacteriumstoichiometricallydiethylmalonylurearecrystallizationsdiethylstilbestrolcounterintuitivelymucopolysaccharidehypercholesteremiamagnetostrictivelymyeloproliferativephenomenologicallyhydroflumethiazide
...View all with 18 letters...
Phrases (609)
bombycilla cedrorunworldly possessionsrevolutionary groupfamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyperomyscus leucopusjohn orley allen tatenavigational system
...View all with 18 letters...
Words (72)
hydrochlorothiazidecinematographicallypolyesterificationsextralinguisticallypolyribonucleotidesextraterritorialityhypersusceptibilityhypolipoproteinemiaparthenogeneticallynonrelativisticallymucopolysaccharideslipopolysaccharidesconceptualisticallydiethylstilbesteroldiethylstilboestrolbacteriochlorophyllphenomenalisticallyphenylthiocarbamideechoencephalographydehydrochlorinatingdehydrochlorinationphosphatidylcholineelectrodynamometersinterconvertibilityphosphoenolpyruvateinterdepartmentallyelectromagneticallycontradistinctivelyelectromechanicallythird-dimensionalityinterferometricallyhysterosalpingogramthree-dimensionalityimpressionisticallyelectrophoretically
...View all with 19 letters...
Phrases (509)
building supply housewater-plantain familyacetylsalicylic acidfamily cyclopteridaejohn millington syngefamily cynoglossidaeseventeen-year locustitalian monetary unitlatvian monetary unitmillimeter of mercury
...View all with 19 letters...
Words (37)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolpolyphiloprogenitiveradioimmunoassayablelymphogranulomatosesimmunocytochemicallymagnetofluiddynamicsbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesroentgenographicallyencephalomyocarditischemotherapeuticallyhydrochlorothiazidespsychopharmacologiesmicrophotometricallysyncategorematicallyhypercholesterolemichypercoagulabilitiesdimethylnitrosamines
...View all with 20 letters...
Phrases (439)
william stanley jevonsyellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaemalawian monetary unitlebanese monetary unitorder myxobacterialesbalaenoptera physalusfamily trachipteridae
...View all with 20 letters...
Words (15)
hypogammaglobulinemiahypersusceptibilitiesstereomicroscopicallyalkylbenzenesulfonateacetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologieselectromyographicallydendrochronologicallypolyvinyl-formaldehydeintersubstitutabilityantiferromagneticallyhypercholesterolemiaspsychotherapeuticallytetrahydrocannabinolsPhrases (300)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsynmalaysian monetary unithelichrysum bracteatumbulgarian monetary unitdesoxyribonucleic acidsri lankan monetary uniteucalyptus fraxinoidesextremely low frequency
...View all with 21 letters...
Words (10)
pentamethylenetetrazolspectrophotometricallyintercomprehensibilityelectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (261)
venezuelan monetary unitlycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaemultiple mononeuropathyloyalist volunteer force
...View all with 22 letters...
Words (4)
carboxymethylcellulosespolytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (183)
family threskiornithidaegeorge macaulay trevelyanposterior pituitary glandmeperidine hydrochlorideyellowstone national parkcalycanthus occidentalisinterlocutory injunctionbangladeshi monetary unitdorothy rothschild parkerrichard brinsley sheridan
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (118)
carnegie mellon universitylouis seymour bazett leakeysubphylum cephalochordatamary wollstonecraft godwinunidentified flying objectprivately held corporationzollinger-ellison syndromebrassica oleracea botrytisdistinguished flying crossalexandre emile jean yersin
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (96)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraemary wollstonecraft shelleyfrancis scott key fitzgeraldcentral intelligence agencyedmund john millington syngepropoxyphene hydrochloridepolystichum acrostichoidesmelanerpes erythrocephalusreligious society of friends
...View all with 25 letters...
Phrases (66)
brassica oleracea gongylodesemployee stock ownership planevelyn arthur saint john waughassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (58)
business environment analysisamerican revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelaugustus welby northmore puginco-operative republic of guyanacommissioned military officernuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (44)
revolutionary people's strugglealeksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland security
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (31)
business environmental analysisaleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderscrutin uninominal voting systemedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalani
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (30)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international payments
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (17)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technologytupac amaru revolutionary movementrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agency
...View all with 31 letters...
Phrases (19)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (14)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agency
...View all with 33 letters...
Phrases (10)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesmassachusetts institute of technologyerasable programmable read-only memoryeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (11)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marynational socialist german workers' partydepartment of defense laboratory systemfraxinus pennsylvanica subintegerrimasecurity intelligence review committee
...View all with 35 letters...
Phrases (10)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillgenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratorykarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysixteen personality factor questionnaireunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay