Words Containing: Y,I,T,I,E,S
(In Any Order)
There are 1,347 words,
1,476 phrases and
0 abbr's with
Y,I,T,I,E,S in.
Best Scoring Words With: Y,I,T,I,E,S
| Expand? | Word | Save? | Length | Usage | Points | Type | |
|---|---|---|---|---|---|---|---|
We couldn't find any valid Scrabble US words with a maximum length of 7. Try increasing the max length or changing the version of the game.
Tip: Scrabble EU allows far more words than US! | |||||||
Words (1)
yitiesWords (45)
intensitysinceritydiversityseniorityintensifyimmensitysterilityhygienistmystifiedfestivitymystifierservilitystymieingmystifieshideosityteriyakistensilityerosivitysectilitycysteinictypifiersidiotypessessilitycytidinessepticityhygieistssylvinitemysticetimythiciseizvestiyaninety-sixpyritisedpyritisespyritizesseriality
...View all with 9 letters...
Phrases (1)
skinny tieWords (66)
universitypositivelyspecialityinsecuritytestifyingelasticitydistillerypitilesslyepisiotomyspiritedlysinisterlysphericitypreciosityinsistencyinsobrietythievishlydyskineticdisquietlymythicizespristinelymyelitidestigerishlythymidineszygositiessewabilitymyositisesemissivitygyniatriesseminuditymystifiershistiocyteessayisticlysimetriccysticerciepiphytism
...View all with 10 letters...
Phrases (4)
silver citytin pyriteswhite daisycystic veinWords (102)
sensitivitysuperioritysensibilityexquisitelyserendipityexclusivityintensivelyfeasibilitybisexualityversatilitysensitivelyspecificityvoyeuristicdomesticityselectivityimpetuosityinsinceritysynergisticreligiosityinsistentlylimitlesslymisidentifyresistivitystipendiarybellicosityperspicuityexpansivitydemystifieddemystifiesintrusivelyvestigiallyvineyardistresilientlysystemizinginsatiately
...View all with 11 letters...
Phrases (10)
high societystinking yewlife historysex activityliberty shipcity slickersylvester iiobesity dietirtysh riveruse immunityWords (174)
sufficientlybiochemistrybiosynthesisbiodiversitysubjectivitydesirabilityintensifyingirresistiblyuniversalitygeophysicistindiscreetlyperspicacitysynthesizinghesitatinglymeticulositysempiternitydispiritedlysimultaneitybiosyntheticsyncretisingblisteringlysyncretizingantiepilepsydemystifyingiridescentlydissymmetricretestifyingplebiscitaryegoisticallydysphemistictheisticallydisloyaltiestypicalitiesintersocietyepiphytotics
...View all with 12 letters...
Phrases (13)
lickety splitchinese deitysemitic deityarmistice daypersian deityinsanity pleapainted daisylimbic systemtissue typingwriting style
...View all with 12 letters...
Words (234)
instinctivelyinterestinglyrealisticallydiscretionaryinconsistencydistressinglycholecystitisinsensitivityaccessibilityinsensitivelyexistentiallydistinctivelyquestioninglyexpeditiouslyphysostigminehypothesisingmagisteriallyosteomyelitispsychokineticproselytizinghypothesizingprecipitouslyinexhaustiblyinstructivelyinquisitivelydiscreditablyinfeasibilityegotisticallyperishabilitybasidiomycetemeasurabilitysqueezabilityspreadabilityobservabilitypietistically
...View all with 13 letters...
Phrases (35)
drimys winterimeibomian cystleyte invasionsocial anxietywriting systembissextile daysilky wisteriatribal societychristian yeartype i diabetes
...View all with 13 letters...
Words (238)
responsibilityscientificallysentimentalityrespectabilityhypersensitivecytogeneticistsusceptibilitymicrochemistrydimensionalityinsufficientlysuperficialityidealisticallypyelonephritissuggestibilityunhesitatinglypraiseworthilybiosystematicsserviceabilitystretchabilityindestructiblypleasurabilitycompensabilityaxisymmetricalhypercriticisminfelicitouslymetaphysiciansdistensibilitybiosystematistpolydispersitypyrimethaminespresentabilityhedonisticallysystemizationshyperrealisticdisappointedly
...View all with 14 letters...
Phrases (52)
field intensitycrime syndicatecitellus parryiidentity crisislight intensitypetty criticismfamily sittidaepublic securityarteria cysticabissextile year
...View all with 14 letters...
Words (214)
physiotherapistconscientiouslysympathomimeticsynergisticallyinaccessibilitysurreptitiouslyinfinitesimallyinstrumentalityrecrystallizingintrospectivelyirresistibilityunquestioninglydispassionatelyinconsideratelyeuphemisticallypessimisticallyvoyeuristicallyimperishabilitysystematizationkinestheticallyinsurrectionaryhypersensitizeddemonstrabilitysidesplittinglyinteruniversitycommiseratinglythyroidectomiesemployabilitiesdemystificationpoliomyelitidesserendipitouslydisenchantinglydishearteninglyhypersalivationpsychometrician
...View all with 15 letters...
Phrases (89)
auditory ossiclepsychotic beliefwassily leontieffamily astacidaerationalise awayspecific gravitydrive line systembrittany spanielmagnetic pyritesmilitary adviser
...View all with 15 letters...
Words (87)
enthusiasticallyindiscriminatelyirresponsibilityquintessentiallysurrealisticallyhypersensitivityneuropsychiatricpolydispersitieshypersalivationsinextinguishablycommensurabilityhypersensitizinghypersexualitiesinexhaustibilitythermoplasticityhyperstimulatinghyperstimulationadministrativelyhyperthyroidismshyperviscositieshypervitaminosesindiscernibilitymonotheisticallyindispensabilitylyginopteridalesphotosensitivityecclesiasticallyperiphrasticallyimpermissibilityrelativisticallykinaestheticallyinsusceptibilityautopolyploidiesstrongyloidiaseslymphangiectasia
...View all with 16 letters...
Phrases (89)
strictly speakingchristian huygensfamily locustidaecalystegia sepiumuninominal systeminternal analysisfamily castoridaeguilty consciencesexual immoralitycortical epilepsy
...View all with 16 letters...
Words (60)
superconductivitymaterialisticallycardiorespiratoryneurophysiologistinconsequentiallyinterdisciplinaryhyperreactivitiesisoelectronicallyphysiotherapeuticspondylolisthesishyperstimulationshyperventilationshypnotizabilitiesmonosyllabicitiespaternalisticallypathophysiologieshyposensitizationunderstandabilityencephalomyelitisdisrespectabilitystereospecificityrecrystallizationstrongyloidosisestridimensionalityindestructibilityimperialisticallyorthopsychiatriestriiodothyroninesjurisprudentiallyneuropsychiatriesneuropsychiatristimpressionabilitydesynchronisationdesynchronizationcomprehensibility
...View all with 17 letters...
Phrases (131)
interstate highwaypetasites hybridusuniversity of parissubfamily lutrinaeuniversity studentsubfamily turdinaedisability benefitdisability paymentstreet credibilityfamily secotiaceae
...View all with 17 letters...
Words (41)
characteristicallydisproportionatelyinconsequentialityhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationhypophysectomizinghyposensitizationscylindrical-stemmedtriphosphopyridinestereospecificallystoichiometricallyrecrystallizationsdiethylstilbestrolmagnetostrictivelygranulocytopoiesisneurophysiologistsneuropsychiatristsdemythologizationselectrophysiologicincommensurabilityhomobasidiomyceteshydroelectricitiessedimentologicallyoveroptimisticallycytoarchitectonicssemiconservativelyhyperalimentationssemiquantitativelydihydroergotaminesdimethylhydrazinesunenthusiasticallydiphenylhydantoinshyperimmunizations
...View all with 18 letters...
Phrases (126)
administrative bodyfamily physeteridaedame sybil thorndikeposterior pituitarynavigational systemcolumbia universitysuperiority complexantipsychotic agentsquirreltail barleyshort-term liability
...View all with 18 letters...
Words (39)
hyperparathyroidismpolyesterificationshypersensitizationsextralinguisticallypolyribonucleotideshypersusceptibilityparathyroidectomiesnonrelativisticallyconceptualisticallycytopathogenicitiesimmunocytochemistrydiethylstilbesteroldiethylstilboestrolphenomenalisticallyphosphatidylcholinecontradistinctivelythird-dimensionalitythree-dimensionalityimpressionisticallyelectrophysiologieselectrophysiologistincomprehensibilityencephalomyelitidesdihydrostreptomycinparasympathomimeticdiethylcarbamazinesdiethylstilbestrolsphytohemagglutininstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminepsychotomimeticallyhyperemotionalitiesdimethyltryptamineshyperexcitabilities
...View all with 19 letters...
Phrases (146)
acetylsalicylic acidjohn millington syngehydrastis canadensisfamily lepisosteidaezairese monetary unitfamily dasyproctidaechinese monetary unitsalicylate poisoninguniversity of chicagosymphytum officinale
...View all with 19 letters...
Words (22)
uncharacteristicallyoverenthusiasticallyhypersensitivenesseshyperadrenocorticismcytodifferentiationsmagnetofluiddynamicsphenylthiocarbamidesdehydrochlorinationsphosphatidylcholinesneuropsychiatricallyelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryencephalomyocarditishydrochlorothiazideshypercoagulabilitiesdimethylnitrosaminesheterobasidiomycetesexistentialisticallyhyperparathyroidismsPhrases (121)
william stanley jevonswyethia amplexicaulisorder mycelia steriliadivision tracheophytauniversity of nebraskaclassification systemclassifying adjectivefriendly relationshipestonian monetary unitfamily gasterosteidae
...View all with 20 letters...
Words (5)
hypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesotorhinolaryngologiesintersubstitutabilityPhrases (97)
malaysian monetary unitsri lankan monetary unitpseudemys rubriventriseucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaptolemy ii philadelphusspectroscopic analysisagricultural chemistryspeech intelligibility
...View all with 21 letters...
Words (3)
intercomprehensibilityelectrophysiologicallyencephalomyocarditisesPhrases (109)
aleksandr i. solzhenitsynsodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroidescrescent city connectionsurinamese monetary unitfamily branchiostomidaeatmospheric electricityjohns hopkins university
...View all with 22 letters...
Words (2)
laryngotracheobronchitisphosphatidylethanolaminePhrases (59)
carnegie mellon universitysubdivision deuteromycotadivision heterokontophytaprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisdistinguished flying crossexistentialist philosophytechnology administrationhypersensitivity reaction
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (59)
francis scott key fitzgeraldedmund john millington syngepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidestrans-alaska pipeline systemsir arthur stanley eddingtonmichelson-morley experimentandrei arsenevich tarkovskyreticular activating system
...View all with 25 letters...
Phrases (38)
hunting and gathering societysubdivision coniferophytinanewton's theory of gravitationsubdivision deuteromycotinabureau of diplomatic securitybenign prostatic hyperplasiapalestine national authoritymyrtillocactus geometrizansconjunctival layer of eyelidsscardinius erythrophthalmus
...View all with 26 letters...
Phrases (43)
business environment analysisnikita sergeyevich khrushchevcommissioned military officernuclear regulatory commissiontricyclic antidepressant drugdeoxythymidine monophosphatejames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenko
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (36)
triphosphopyridine nucleotidefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevskymaster of arts in library sciencedissident irish republican armyrevolutionary communist leaguecount lev nikolayevitch tolstoy
...View all with 28 letters...
Phrases (24)
business environmental analysisacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systemmiddle east respiratory syndromepresident william henry harrisonultrasonic pulse velocity tester
...View all with 29 letters...
Phrases (22)
alexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepository financial institutionbalance of international paymentswaterhouse-friderichsen syndromecalymmatobacterium granulomatiscalifornia personality inventorynontricyclic antidepressant drug
...View all with 30 letters...
Phrases (12)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseaserevolutionary proletarian nucleusprimary subtractive color for lightrichard august carl emil erlenmeyerfibrocystic disease of the pancreasmarine corps intelligence activityhuygens' principle of superposition
...View all with 31 letters...
Phrases (18)
hierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for lighttheory of electrolytic dissociation
...View all with 32 letters...
Phrases (11)
autonomous sensory meridian responselycopersicon esculentum cerasiformenondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systempositron emission tomography scannersubacute inclusion body encephalitisunited states intelligence community
...View all with 33 letters...
Phrases (9)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (8)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsocialist people's libyan arab jamahiriyaPhrases (10)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccineu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesus army criminal investigation laboratorysixteen personality factor questionnaireunited states national library of medicine
