Words Containing: Y,I,T,I,E
(In Any Order)
There are 2,676 words,
2,512 phrases and
0 abbr's with
Y,I,T,I,E in.
Best Scoring Words With: Y,I,T,I,E
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| impiety | 7 | 14 | nounn | |||||
noun • unrighteousness by virtue of lacking respect for a god | ||||||||
| nimiety | 7 | 12 | nounn | |||||
noun • a quantity much larger than is needed | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
yitieWords (1)
yitiesWords (45)
identityidentifyfidelityfelicitycitywidesenilityteriyakifeminityinequitymyelitistypifieddebilitygelidityexiguitytepiditycytidinecityfiedfeistilysyenitictypifiertypifiesfinitelyinverityhelicityequinityidealityfetidityfelinitypyelitisidiotypehygieistpyeliticidoneityvinylitemoyities
...View all with 8 letters...
Phrases (1)
city lineWords (103)
integrityintensitysinceritydiversityfertilityitineraryingenuityseniorityethnicityindemnitycitizenryintensifyimmensitysterilityhygienistmystifiedfestivitygentilityintercityedibilitygenialitypuerilitylimitedlybenignitymystifierfebricityfebrilitymendicityservilityirrealityinebrietydeclivityferviditystymieingmystifies
...View all with 9 letters...
Phrases (6)
tiger lilywhite lilyin realityptolemy iiskinny tieinner cityWords (176)
definitelyuniversityterrifyingcreativitypositivelyinevitablyspecialityinsecurityinfidelitytestifyingrelativityinfinitelyintimatelyindirectlymediocritynegativityexplicitlyfemininitydiligentlylegitimacyinequalityelasticityilliteracydistilleryillegalitycertifyingintrepidlypitilesslyrectifyingimbecilityepisiotomyequanimityimminentlyliberalityspiritedly
...View all with 10 letters...
Phrases (15)
hindu deityiron pyritesilver cityitalian ryetin pyritesitem-by-itemwhite daisydirty linenmexico citycystic vein
...View all with 10 letters...
Words (297)
immediatelyelectricitycredibilitysensitivityidentifyingflexibilitysuperiorityefficientlyinferioritysensibilityobjectivityreliabilityimpatientlyinfertilityexquisitelyeligibilityserendipityevidentiaryintuitivelyexclusivityintensivelymaterialityreciprocitytypewritingpeculiarityimproprietyfeasibilityintricatelybisexualityversatilityincredulityprimitivelyintrepiditysensitivelyspecificity
...View all with 11 letters...
Phrases (22)
billy the kidmiddle fiftycopy editingceltic deitydivine unityignition keygild the lilyhigh societykitty litterstinking yew
...View all with 11 letters...
Words (387)
incidentallyindefinitelysufficientlypenitentiarydefinitivelyauthenticityintermediarybiochemistrytechnicalityfigurativelybiosynthesistriglyceridebiodiversitylegitimatelyelectrifyingsubjectivitydesirabilityterrificallyeccentricityinextricablyconnectivitycongenialityterrifyinglyproficientlyhyperaciditycollectivitycoincidentlyirregularityintensifyingirresistiblyevidentiallyexcitabilitypotentialityuniversalitygeophysicist
...View all with 12 letters...
Phrases (32)
lickety splitchinese deityinquiry agentsemitic deityin perpetuitytighty whiteyarmistice daydivinyl ethertympanic veincivil liberty
...View all with 12 letters...
Words (493)
intentionallyinstinctivelyvulnerabilityinterestinglyrealisticallyintelligentlyfrighteninglyirretrievablymagnificentlynitroglycerindiscretionaryexpeditionarybelievabilityhyperactivityinconsistencyimperceptiblyindifferentlymarketabilitydistressinglycholecystitisinsensitivityinevitabilityaccessibilitydependabilityaffirmativelycompetitivelytheatricalityunremittinglyinsensitivelyinefficientlyexistentiallydistinctivelyqualitativelyinflexibilitydiametrically
...View all with 13 letters...
Phrases (79)
bitter hickoryinventory itemdrimys winteriadmiralty milebilly mitchellprime quantityphrygian deityforbidden citylillie langtrymeibomian cyst
...View all with 13 letters...
Words (416)
responsibilityscientificallycoincidentallysentimentalityrespectabilityhypersensitiveintentionalitycytogeneticistconfidentiallyterritorialitynitroglycerineexcruciatinglyintermittentlypredictabilityclitoridectomysusceptibilitynephrotoxicitymicrochemistrydimensionalityinconvenientlyinsufficientlyunintelligiblyconvertibilityappreciativelysuperficialityinheritabilitypolymerizationintermediatelyentertaininglydifferentiallyidealisticallypyelonephritisprovidentiallyreconciliatorydirectionality
...View all with 14 letters...
Phrases (117)
field intensitywilliam tyndalefamily turdidaefamily bothidaeright to libertyutility routinefifty-cent piececrime syndicatecitellus parryiidentity crisis
...View all with 14 letters...
Words (340)
confidentialityextraordinarilyinternationallyunintentionallyinappropriatelyphysiotherapistconscientiouslysympathomimeticsynergisticallyinaccessibilityintellectualitysurreptitiouslyplenipotentiarymaneuverabilityinfinitesimallyinstrumentalityinvulnerabilityrecrystallizingintrospectivelyunacceptabilityirresistibilityunquestioninglyauthoritativelydispassionatelyinconsideratelyeuphemisticallypessimisticallyconventionalityvoyeuristicallyinterrogativelyimperishabilitysystematizationkinestheticallyinsurrectionarycontemptibility
...View all with 15 letters...
Phrases (172)
auditory ossiclefamily tinamidaefamily artamidaepsychotic beliefwassily leontieffamily astacidaefamily triglidaerationalise awayspecific gravityfamily blattidae
...View all with 15 letters...
Words (150)
enthusiasticallyindiscriminatelyirresponsibilityhyperintelligentunpredictabilityhyperventilationquintessentiallyimperceptibilitysurrealisticallyincontrovertiblyhypersensitivityinconceivabilityneuropsychiatricpolydispersitieshypersalivationsinextinguishablycolorimetricallyexterritorialitytrinitroglycerincommensurabilityhypersensitizingnoncompetitivelyhypersexualitiesinexhaustibilitythermoplasticityhyperstimulatinghyperstimulationadministrativelyimperfectibilityhyperthyroidismsdimethylglyoximehyperventilatinghyperviscositieshypervitaminosesindiscernibility
...View all with 16 letters...
Phrases (204)
italian greyhoundstrictly speakingchristian huygensdefinite quantityefficiency expertvariable quantityfamily locustidaerelative majoritythai monetary unitcalystegia sepium
...View all with 16 letters...
Words (106)
unconventionalitybacteriologicallysuperconductivitymaterialisticallycardiorespiratoryneurophysiologistinconsequentiallyinterdisciplinaryantirevolutionaryhyperreactivitiesisoelectronicallyphysiotherapeuticunexchangeabilitythermoperiodicityspondylolisthesishyperstimulationshyperventilationshypnotizabilitiesmonosyllabicitiespaternalisticallypathophysiologieshyposensitizationarchitectonicallyferrimagneticallyunderstandabilityencephalomyelitisdisrespectabilityhyperalimentationstereospecificitycytopathogenicityrecrystallizationimmunogeneticallyelectronegativitystrongyloidosisesthiodiphenylamine
...View all with 17 letters...
Phrases (235)
interstate highwayfamily trochilidaepetasites hybridusuniversity of parissubfamily lutrinaeuniversity studentsubfamily turdinaefamily bucerotidaedisability benefitdisability payment
...View all with 17 letters...
Words (55)
characteristicallydisproportionatelyinconsequentialityhypercoagulabilityinterchangeabilityhypersensitivenesspolyesterificationhypersensitivitieshypersensitizationpolyribonucleotidehypophysectomizinghyposensitizationsanthropocentricitycylindrical-stemmedtriphosphopyridinestereospecificallyimmunocytochemicalstoichiometricallyrecrystallizationsdiethylstilbestrolcounterintuitivelymagnetostrictivelymyeloproliferativehydroflumethiazidegranulocytopoiesispolypropenonitrileneurophysiologistsneuropsychiatristsdemythologizationselectrophysiologicincommensurabilityhomobasidiomyceteshydroelectricitiessedimentologicallyoveroptimistically
...View all with 18 letters...
Phrases (240)
administrative bodyfamily physeteridaedame sybil thorndikeeriobotrya japonicaposterior pituitarynavigational systemcolumbia universityfamily trichechidaesuperiority complexmetric capacity unit
...View all with 18 letters...
Words (53)
hyperparathyroidismhydrochlorothiazidecinematographicallypolyesterificationshypersensitizationsextralinguisticallypolyribonucleotidesextraterritorialityhypersusceptibilityparathyroidectomieshypolipoproteinemianonrelativisticallycytodifferentiationconceptualisticallycytopathogenicitiesimmunocytochemistrydiethylstilbesteroldiethylstilboestrolphenomenalisticallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholineinterconvertibilitycontradistinctivelythird-dimensionalityinterferometricallythree-dimensionalityimpressionisticallyelectrophysiologieselectrophysiologistdeoxyribonucleotideincomprehensibilitymicroelectronicallyencephalomyelitides
...View all with 19 letters...
Phrases (255)
water-plantain familyacetylsalicylic acidfamily cyclopteridaejohn millington syngeitalian monetary unithydrastis canadensislatvian monetary unitmillimeter of mercuryalpine type of glacierfamily lepisosteidae
...View all with 19 letters...
Words (27)
uncharacteristicallyoverenthusiasticallyhypersensitivenessespolyphiloprogenitiveparathyroidectomizedhyperadrenocorticismcytodifferentiationsimmunocytochemicallymagnetofluiddynamicsphenylthiocarbamidesdehydrochlorinationsphosphatidylcholinesneuropsychiatricallyhyperlipoproteinemiaelectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryencephalomyocarditishydrochlorothiazidesmicrophotometricallyhypercoagulabilitiesdimethylnitrosaminesheterobasidiomycetesexistentialisticallyhyperparathyroidismsPhrases (222)
william stanley jevonswyethia amplexicaulisorder mycelia steriliamalawian monetary unitfamily trachipteridaedivision tracheophytaclyde william tombaughuniversity of nebraskaclassification systemclassifying adjective
...View all with 20 letters...
Words (6)
hypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesotorhinolaryngologiesintersubstitutabilityantiferromagneticallyPhrases (170)
icelandic monetary unitmalaysian monetary unitbulgarian monetary unithungarian monetary unitsri lankan monetary unitbyzantine architecturetanzanian monetary unitpseudemys rubriventriseucalyptus fraxinoidesisle royal national park
...View all with 21 letters...
Words (3)
intercomprehensibilityelectrophysiologicallyencephalomyocarditisesPhrases (164)
hydrated aluminium oxidealeksandr i. solzhenitsynfamily dendrocolaptidaesodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroidescrescent city connectionnicaraguan monetary unitsurinamese monetary unit
...View all with 22 letters...
Words (1)
hypobetalipoproteinemiaPhrases (101)
family threskiornithidaeposterior pituitary glandkazakhstani monetary unitcalycanthus occidentalisparis-sorbonne universityinterlocutory injunctionkyrgyzstani monetary unitbangladeshi monetary unittyrosine kinase inhibitortajikistani monetary unit
...View all with 23 letters...
Words (5)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyPhrases (82)
carnegie mellon universitysubdivision deuteromycotadivision heterokontophytaunidentified flying objectprivately held corporationprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisdistinguished flying crossantiarrhythmic medication
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (77)
francis scott key fitzgeraldcentral intelligence agencyedmund john millington syngepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkinsir arthur stanley eddingtonmichelson-morley experiment
...View all with 25 letters...
Phrases (51)
hunting and gathering societysubdivision coniferophytinanewton's theory of gravitationsubdivision deuteromycotinabureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authoritymyrtillocactus geometrizansconjunctival layer of eyelids
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (51)
business environment analysisamerican revolutionary leadernikita sergeyevich khrushchevco-operative republic of guyanacommissioned military officernuclear regulatory commissiontricyclic antidepressant drugdeoxythymidine monophosphatejames augustine aloysius joycethyrotropin-releasing hormone
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (44)
triphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevskymaster of arts in library sciencedissident irish republican armyrevolutionary communist league
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (30)
business environmental analysisacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndromeunited arab emirate monetary unit
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (26)
alexander isayevich solzhenitsynobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndromepolymonium caeruleum van-bruntiae
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (17)
great smoky mountains national parkfreedom from involuntary servitudedigital communications technology2019-ncov acute respiratory diseaserevolutionary proletarian nucleusprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agency
...View all with 31 letters...
Phrases (19)
hierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory druguniversity of california at berkeleyprimary subtractive colour for lighttheory of electrolytic dissociation
...View all with 32 letters...
Phrases (15)
autonomous sensory meridian responselycopersicon esculentum cerasiformenondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economy
...View all with 33 letters...
Phrases (9)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's general theory of relativityeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (9)
communications security establishmentrevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycanadian security intelligence serviceimmaculate conception of the virgin marynational socialist german workers' partyfraxinus pennsylvanica subintegerrimasecurity intelligence review committeePhrases (8)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsocialist people's libyan arab jamahiriyaPhrases (10)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccineu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesus army criminal investigation laboratorysixteen personality factor questionnaireunited states national library of medicine
