Words Containing: Y,I,E,L,D
(In Any Order)
There are 2,068 words,
2,503 phrases and
0 abbr's with
Y,I,E,L,D in.
Best Scoring Words With: Y,I,E,L,D
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| fixedly | 7 | 21 | adverbadv | |||||
adverb • in a fixed manner | ||||||||
| dialyze | 7 | 20 | verbv | |||||
verb • separate by dialysis | ||||||||
| mixedly | 7 | 20 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| mildewy | 7 | 16 | adjectiveadj | |||||
adjective • Of, pertaining to, or affected with mildew | ||||||||
| weirdly | 7 | 14 | adverb, adjectiveadv, adj | |||||
adverb • in a weird manner | ||||||||
| devilry | 7 | 14 | nounn | |||||
noun • wicked and cruel behavior • reckless or malicious behavior that causes discomfort or annoyance in others | ||||||||
| fetidly | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| headily | 7 | 14 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| weedily | 7 | 14 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
| widely | 6 | 13 | adverbadv | |||||
adverb • to a great degree • to or over a great extent or range; far • so as to leave much space or distance between | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
yieldWords (40)
snidelyreadilyideallyweirdlymyeloiddiddleydevilryfixedlydialyzetiredlytepidlyseedilyreedilybylinedneedilyfetidlygelidlymixedlymildewyeyelidsyieldeddialyseheadilyridleyslydditeyielderbeadilydoyliesweedilylygaeidkaylieddiethyltiddleyfiddleyeyeliad
...View all with 7 letters...
Phrases (4)
slide bywild ryeyield upglide byWords (110)
directlyfriendlydeliveryideologycylinderdelicacyfidelitysteadilyyodelingdyslexicyieldingdimethylladylikedivinelyyuletidewickedlydyslexiamediallycrediblystylizedunwieldydialyzedspeedilygreedilydreamilystyliseddiphenylmaidenlyunitedlydeviltrysoldieryhayfielddebilitysedulityslideway
...View all with 8 letters...
Phrases (7)
egg yieldlive bodydevil rayyard linedaily dewlay asidefield dayWords (165)
evidentlydisplayedmedicallyexcitedlyhurriedlydecidedlyhideouslytediouslyglycosidecredulitydefiantlysoldierlypointedlyadvisedlyindeliblyyodellingedibilityworriedlycordylinedyslecticdeviouslylimitedlyeruditelyglyceridediverselydeclivityholidayerunaidedlydirefullydialysatebeladyingcylindersdialyzateyuletidesdesirably
...View all with 9 letters...
Phrases (11)
milk yieldold baileyearly birddevil lilywild thymejenny lindadobe lilydeadly sinblue daisyfly bridge
...View all with 9 letters...
Words (219)
definitelyincrediblydisneylandinfidelityunderlyingdiscreetlyindirectlydisorderlyunfriendlyadmittedlydelicatelydiligentlysymbolizedsplendidlyundeniablyunyieldingdiscretelydecisivelyindecentlydistilleryyellowbirdepicondylesymbolisedmindlesslyobedientlydevilishlyintrepidlyfiendishlyimpudentlyladyfingerstridentlyunmaidenlycyclopediaunsteadilyimmodestly
...View all with 10 letters...
Phrases (34)
line of dutyfield pansyaniline dyepineal bodyblind alleyleydig celllady killerdaily breaddaily orderwalt disney
...View all with 10 letters...
Words (300)
immediatelydifferentlycredibilityexceedinglypsychedelicdelinquencyconfidentlydeliverymandeliciouslydeceitfullydeceptivelydefensivelybodybuilderpredictablyvaledictorydoxycyclineexpedientlydeliriouslyseductivelypsychedeliadishonestlyincredulitymelodicallydeservinglyidenticallydisgustedlydelightedlydissolutelyundesirablysecondarilycomedicallymedicinallydeafeninglyimprudentlyunhurriedly
...View all with 11 letters...
Phrases (52)
dry cleaningdwindle awaymemorial daybilly the kidbilly wilderalkyl halidecurly endivedisplay casefive-year-oldmiddle fifty
...View all with 11 letters...
Words (333)
accidentallydeliberatelyincidentallyindefinitelyconsiderablyencyclopediadefinitivelyperiodicallytriglyceridedelightfullycrystallizedacademicallydomesticallydesirabilitymethodicallyinadequatelypolicyholderbegrudginglycoincidentlyevidentiallyepidemiologydepressinglydespairinglyresoundinglyencyclopedicmythologizedindelicatelyindiscreetlycardiomegalydespitefullyimmoderatelyidentifiablydeterminablyinordinatelycrystallised
...View all with 12 letters...
Phrases (76)
admiral deweyread-only filematerial bodydevil-may-carefamily boidaejail deliveryfolding moneyfamily zeidaecare deliverysundew family
...View all with 12 letters...
Words (305)
independentlyinadvertentlypredominantlyideologicallyencyclopaediaindifferentlydistressinglyhydroelectrichydrochloridedependabilitydimensionallypredominatelyeducationallydistinctivelyendocrinologyincredulouslydiametricallyindescribablydisgracefullyexpeditiouslyquadrenniallyhydrosulphideuninhibitedlyendolymphaticconsideratelyunqualifiedlydeferentiallyhydrocephalicencyclopaedicunpredictablycreditabilityclandestinelyradioactivelyindefatigablydiscreditably
...View all with 13 letters...
Phrases (136)
el iskandriyahfamily laridaefamily picidaeadmiralty milefamily bovidaeedmund hillarygenus dactylisamyloid plaquebenzyl radicalhenry fielding
...View all with 13 letters...
Words (240)
coincidentallydemocraticallyconfidentiallypredictabilityclitoridectomyreproductivelydiscourteouslydimensionalityinconsiderablyintermediatelydifferentiallyidealisticallyprovidentiallyorthopedicallydemythologiseddirectionalitydisconsolatelydemythologizeddisingenuouslyabsentmindedlydeliberativelydiscontentedlydepolymerizingdenumerabilityindestructiblylightheartedlygeohydrologistpolybutadienespolynucleotideupgradeabilityunrestrainedlyambidextrouslydistensibilityspellbindinglypolydispersity
...View all with 14 letters...
Phrases (186)
field intensitymoonseed familywilliam tyndaledimethyl ketonefamily ardeidaeveliky novgorodadmiralty metalpolymeric amidefamily turdidaeblended whiskey
...View all with 14 letters...
Words (169)
confidentialityextraordinarilydisrespectfullycondescendinglyaerodynamicallymethylphenidateuninterruptedlydemonstrativelydispassionatelycorrespondinglydemographicallyinconsideratelyperpendicularlydemonstrabilitysidesplittinglyreproducibilitybidirectionallypsychedelicallyhydromechanicalimponderabilitypoliomyelitidespolysaccharidesserendipitouslydisenchantinglydishearteninglyautotetraploidyhyperstimulatedhydroxylapatitesophisticatedlyradiometricallydisinterestedlysemicylindricaldorsoventralitypolynucleotidesdisconcertingly
...View all with 15 letters...
Phrases (259)
auditory ossiclehelen wills moodydialysis machinefamily tinamidaemail-order buyingby trial and errorfamily leporidaefamily artamidaefamily astacidaefamily triglidae
...View all with 15 letters...
Words (54)
indiscriminatelyunpredictabilitypolydispersitiesadministrativelydimethylglyoximeindiscernibilityleukodystrophiesperpendicularityindispensabilitylyginopteridalesdenominationallycyclophosphamideindefatigabilityautopolyploidiesstrongyloidiasesdecarboxylationsdodecaphonicallyoligodendrocyteshydroelectricityleptotyphlopidaebiodegradabilityindescribabilityadenohypophysialelectrohydraulicinterdependentlyhyperlipoidaemiaallopolyploidiesmethylphenidatesphyllostomatidaehendecasyllabicsundemocraticallydepolymerizationancylostomatidaeencyclopedicallyendopolyploidies
...View all with 16 letters...
Phrases (244)
hypodermic needleitalian greyhoundfamily cyprinidaecardiac glycosidefamily locustidaefamily balaenidaelaundry stiffenerfamily elateridaefamily blenniidaeisland of guernsey
...View all with 16 letters...
Words (43)
thermodynamicallyinterdisciplinaryself-contradictorycercidiphyllaceaekaleidoscopicallyspondylolisthesisunderstandabilitydisrespectabilitylymphadenopathiescyclophosphamidesstrongyloidosisesthiodiphenylaminedehydrochlorinasedehydrochlorinatetridimensionalityptilonorhynchidaeindestructibilityjurisprudentiallydisadvantageouslyturbidimetricallydeoxyribonucleasedephosphorylatingdephosphorylationdepolymerizationsdiphenylhydantointwo-dimensionalityphotoperiodicallyone-dimensionalityirreproducibilitydeterministicallyuncomprehendinglyepidemiologicallyhydroelectricallyhydrometallurgiesdialectologically
...View all with 17 letters...
Phrases (259)
family dasypodidaecylinder separatorfamily trochilidaefamily didelphidaecaesarian deliveryfamily droseraceaedisorderly conducthexadecimal systemmiles dewey davis jr.family engraulidae
...View all with 17 letters...
Words (29)
disproportionatelyhyperaldosteronismpolyribonucleotidecylindrical-stemmedlipopolysaccharidediethylmalonylureadiethylstilbestrolmucopolysaccharidehydroflumethiazidedehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologydemythologizationsmethylprednisolonedeoxyribonucleasesdephosphorylationshydroxychloroquinecholecystectomizedhydroelectricitieshydrometallurgicalsedimentologicallyhydrometallurgistshydrometeorologieshydrometeorologistdiethylcarbamazinedimethylhydrazinesdimethyltryptaminediphenylhydantoinsPhrases (222)
bombycilla cedrorunworldly possessionsfamily physeteridaedame sybil thorndikefreudian psychologypodilymbus podicepsread-only memory chipkilocycle per secondfamily trichechidaefamily desmidiaceae
...View all with 18 letters...
Words (27)
hydrochlorothiazidepolyribonucleotidesmucopolysaccharideslipopolysaccharidesdiethylstilbesteroldiethylstilboestrolphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholineinterdepartmentallycontradistinctivelythird-dimensionalitythree-dimensionalitymethylprednisolonesdeoxyribonucleotideencephalomyelitideshydroxytetracyclinehydrometeorologicalhydrometeorologistsdiethylcarbamazinesdiethylstilbestrolstetramethyldiarsinedimethylnitrosaminedimethyltryptamineselectrocardiographymultidimensionalityPhrases (225)
building supply houseacetylsalicylic acidfamily cyclopteridaefamily cynoglossidaefamily lepisosteidaefamily dasyproctidaefamily polypodiaceaehydrobates pelagicusliquid body substancesubfamily perdicidae
...View all with 19 letters...
Words (10)
tetrahydrocannabinolradioimmunoassayablemagnetofluiddynamicsphenylthiocarbamidesdehydrochlorinationsphosphatidylcholinesdeoxyribonucleotidesencephalomyocarditishydrochlorothiazidesdimethylnitrosaminesPhrases (197)
yellow-shafted flickerorder mycelia steriliaorder myxobacterialesfamily trachipteridaeclyde william tombaughfamily dermochelyidaesuricata tetradactylafamily pseudococcidaeambystomid salamanderclassifying adjective
...View all with 20 letters...
Words (3)
dendrochronologicallypolyvinyl-formaldehydetetrahydrocannabinolsPhrases (117)
icelandic monetary unitelectrolytic condenseraleksandr solzhenitsyndesoxyribonucleic acideucalyptus fraxinoidesfamily rhinotermitidaeptolemy ii philadelphusprocaine hydrochloridesamuel taylor coleridgefamily myrmecophagidae
...View all with 21 letters...
Words (2)
encephalomyocarditisesdihydroxyphenylalaninePhrases (116)
redevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynfamily dendrocolaptidaesubfamily bassariscidaesodium tripolyphosphatehigh-density lipoproteinrhythm and blues musicianathyrium thelypteroides
...View all with 22 letters...
Words (2)
electrocardiographicallyphosphatidylethanolaminePhrases (55)
mary wollstonecraft godwinunidentified flying objectprivately held corporationzollinger-ellison syndromedistinguished flying crossalexandre emile jean yersinapocynum androsaemifoliumfluoxetine hydrocholoridetechnology administrationfederal republic of germany
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (45)
francis scott key fitzgeraldedmund john millington syngepropoxyphene hydrochloridepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidessir arthur stanley eddingtonlepidocybium flavobrunneumreticuloendothelial systemarab revolutionary brigades
...View all with 25 letters...
Phrases (32)
brassica oleracea gongylodescharles maurice de talleyrandrevolutionary calendar monthbureau of diplomatic securityentandrophragma cylindricumgilles de la tourette syndromeconjunctival layer of eyelidsuniformly decelerated motionrhythm method of birth controlhereditary cerebellar ataxia
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (29)
american revolutionary leaderholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkincommissioned military officertricyclic antidepressant drugtopical prostaglandin eyedropfalkland islands monetary unitatrioventricular nodal rhythmhydraulic transmission system
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (20)
aleksandr feodorovich kerenskytriphosphopyridine nucleotideoxytetracycline hydrochloridefyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armysodium carboxymethyl cellulose
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (18)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disordermiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonfrancisco jose de goya y lucientestheory of punctuated equilibriumfyodor mikhailovich dostoyevsky
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (14)
alexander isayevich solzhenitsyndepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidnontricyclic antidepressant drughenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trendsbasic point defense missile systemdisseminated lupus erythematosus
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (8)
freedom from involuntary servitudedigital communications technologydiego rodriguez de silva y velazquezrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyermarie anne charlotte corday d'armontovulation method of family planningmary godwin wollstonecraft shelleyPhrases (10)
nikolai andreyevich rimski-korsakovsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugtheory of electrolytic dissociationyevgeni aleksandrovich yevtushenkoattorney general of the united statesadult respiratory distress syndromejohn f. kennedy international airportPhrases (1)
enzyme-linked-immunosorbent serologic assay
