Words Containing: Y,I,C,K,E,R
(In Any Order)
There are 69 words,
240 phrases and
0 abbr's with
Y,I,C,K,E,R in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
crickey | 7 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
rickety | 7 | 16 | adjectiveadj | |||||
adjective satellite • inclined to shake as from weakness or defect • affected with, suffering from, or characteristic of rickets • lacking bodily or muscular strength or vitality | ||||||||
yuckier | 7 | 16 | adverb, adjectiveadv, adj | |||||
adjective • Of something highly offensive; causing aversion or disgust. | ||||||||
rickeys | 7 | 16 | nounn | |||||
noun • a mixed drink made of sweetened lime juice and soda water usually with liquor | ||||||||
rickey | 6 | 15 | verb, nounv, n | |||||
noun • a mixed drink made of sweetened lime juice and soda water usually with liquor | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (9)
blackberryingfairnytickleskitty-corneredhydrokineticsknickknackeryprickly-leafedprickly-leavedkeratomycosispsychometrikaPhrases (12)
bitter hickoryrichard leakeycylinder blocknutmeg hickorykinetic energykinetic theorycheckered lilybrake cylindercycle rickshawice-hockey rink
...View all with 13 letters...
Words (7)
hyperkeratoticheterokaryoticmegakaryocytichydrokineticalblackberry-lilyblackberryingshuckleberryingPhrases (15)
kyrgyz republicdynamic speakerstanley kubrickrockrose familydesk dictionaryhydraulic brakefriedrich hayekhenry clay frickrichard starkeysticky geranium
...View all with 14 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay