Words Containing: Y,I,C,E
(In Any Order)
There are 5,246 words,
4,324 phrases and
0 abbr's with
Y,I,C,E in.
Best Scoring Words With: Y,I,C,E
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
cyclize | 7 | 23 | verbv | |||||
verb • To undergo, or cause to undergo, a reaction resulting in the formation of an aromatic or ring structure. | ||||||||
enzymic | 7 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hexylic | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
cliquey | 7 | 21 | adjectiveadj | |||||
adjective • Having the characteristics of a clique | ||||||||
pyrexic | 7 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hickeys | 7 | 19 | verb, nounv, n | |||||
noun • a small inflamed elevation of the skin; a pustule or papule; common symptom in acne • a temporary red mark on a person's skin resulting from kissing or sucking by their lover | ||||||||
hickey | 6 | 18 | nounn | |||||
noun • a small inflamed elevation of the skin; a pustule or papule; common symptom in acne • a temporary red mark on a person's skin resulting from kissing or sucking by their lover | ||||||||
chiefly | 7 | 18 | adverb, adjectiveadv, adj | |||||
adverb • for the most part | ||||||||
mickeys | 7 | 18 | nounn | |||||
noun • (ethnic slur) offensive term for a person of Irish descent | ||||||||
crickey | 7 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (66)
societybicyclechimneycyanidespecifycertifyrectifyviceroyricketychieflyglycinecliqueyecdysisclerisyspiceryacetifytechilycinderypyrexicmyceliacysteinpyreticcyclizeenzymicmickeyshexylicethylicyuckiercylicesgyneciagyneciccyaninehyaenicwinceyshickeys
...View all with 7 letters...
Phrases (2)
the cityacid dyeWords (211)
securitydirectlyvelocitycylinderdelicacyfelicityfiercelyactivelyhygieniccelibacymckinleytrickerytricycleliteracydyslexicsystemicleniencyhysterictenacityefficacyferocityeurydicecitywideunicycleprincelywickedlycrediblyveracitypicayunebitcheryglycerincineraryeyepiececheerilycolliery
...View all with 8 letters...
Phrases (11)
by choiceby inchesmagic eyecebu citytonic keyclay pipebasic dyecity deskcity lineice lolly
...View all with 8 letters...
Words (352)
certainlypreciselydiscoverycelebritychemistryspeciallyspecialtysincerelycertaintymachineryhypocritenecessitysinceritysyntheticrecyclingsyndicatedirectoryhierarchymedicallyresidencyobscenityexcitedlyhystericsethicallyethnicitycryogenicdecidedlycitizenryindecencyembryonicglycerineayurvedicconveyingglycosideprecocity
...View all with 9 letters...
Phrases (29)
by machinedirect dyeitchy feetlike crazygin rickeyqueen citywrite copypin cherryin any casecivil year
...View all with 9 letters...
Words (529)
especiallyincrediblyhystericalcreativityefficiencypresidencyspecialitycomplexityinsecuritydiscreetlydeficiencysystematicindirectlyverticallychemicallymediocrityencryptionincendiaryexplicitlydelicatelybricklayercreativelyinnocentlyinsurgencystrychninelegitimacysyndicatedinadequacyelasticityheroicallydiscretelycyberneticimpeccablycountywidedecisively
...View all with 10 letters...
Phrases (52)
by the piecemt. mckinleyleydig cellglycine maxpyknic typein-your-facecopy editorsilver citypuebla citylickety cut
...View all with 10 letters...
Words (741)
electricitynecessarilytechnicallycountrysidecredibilitysympatheticgeneticallyeffectivelyexclusivelyuncertaintybeneficiaryreactionaryconsistencysymmetricalmercilesslycontingencyexceedinglyexcessivelyefficientlypsychedelicobjectivelyobjectivitysynchronizehyperactiveincessantlydelinquencyconfidentlydiscrepancyincorrectlypolytechnicmetaphysicsaerodynamiccrystallineconceivablyselectively
...View all with 11 letters...
Phrases (109)
special jurydry cleaningfilthy lucrebicycle racebicycle seatmystic jewelafrican greypolicy makerclosely knitvena cystica
...View all with 11 letters...
Words (818)
specificallyaccidentallyincreasinglyincidentallysufficientlyconsiderablygynecologistencyclopediaconsistentlysynchronizedhypotheticaleconomicallyauthenticitycollectivelyconvenientlymetaphysicalconstituencyhystericallyperiodicallybiochemistrymeticulouslytechnicalitycommerciallytriglyceridepatheticallyaerodynamicsinexplicablyconclusivelycrystallizedmechanicallyasymmetricalrespectivelyelectrifyingacademicallyhieroglyphic
...View all with 12 letters...
Phrases (145)
molly pitchergenus glycinelickety splithockey clinicathletic typechinese deityacrylic fiberascension dayacrylic resinbicycle wheel
...View all with 12 letters...
Words (798)
unnecessarilytheoreticallyexceptionallyinstinctivelycomplimentaryhieroglyphicsgynaecologistrealisticallyprecautionarystrategicallycategoricallycomparativelymagnificentlynitroglycerinstereotypicalconsecutivelyideologicallysuperficiallyunequivocallydiscretionarybiotechnologyhyperactivityunsympatheticaestheticallyinconsistencyimperceptiblyconfectioneryencyclopaediahypoglycaemicinterlocutorycholecystitisthyroidectomyenergeticallyinsufficiencyhydroelectric
...View all with 13 letters...
Phrases (211)
harvey cushingaleatory musicdirect antonymbitter hickoryfamily picidaemount mckinleyfamily poaceaecooley's anemiaacrylate resinbilly mitchell
...View all with 13 letters...
Words (659)
scientificallyhypotheticallycinematographysystematicallyintellectuallycoincidentallymetaphoricallyaffectionatelyelectronicallydemocraticallymathematicallyrespectabilitygeographicallyalphabeticallycytogeneticistconfidentiallythermodynamicsnitroglycerineexcruciatinglyconservativelyconventionallypredictabilitychemosynthesisclitoridectomypsychoneuroticsusceptibilitygynaecologicalmetaphysicallymetempsychosistelepathicallynephrotoxicityreproductivelydiscourteouslynarcosynthesismicrochemistry
...View all with 14 letters...
Phrases (309)
family apiaceaeorder mysidaceahigh technologysabbatical yearcapital of kenyapolymeric amidecooley's anaemiaabstract entitychinese parsleyfamily ulmaceae
...View all with 14 letters...
Words (497)
confidentialitypsychotherapisttechnologicallydisrespectfullyconscientiouslysympathomimeticsynergisticallyinaccessibilityintellectualityparentheticallycondescendinglyaerodynamicallytherapeuticallycontroversiallysuccinylcholinecytomegaloviruscompassionatelyuncomplimentarystereochemistryrecrystallizingintrospectivelyunacceptabilityseismologicallysympatheticallyarchitecturallycorrespondinglyretrospectivelydemographicallyunceremoniouslyinconsideratelyeuphemisticallyneuropsychiatrypessimisticallycomprehensivelyconventionality
...View all with 15 letters...
Phrases (391)
auditory ossiclestay of executionbenefit of clergydialysis machinefamily lemnaceaeadvisory servicefamily arecaceaepsychotic beliefgenus bombycillahyoscyamus niger
...View all with 15 letters...
Words (220)
enthusiasticallyindiscriminatelyhemorrhoidectomyincomprehensiblyunpredictabilityphylogeneticallyimperceptibilitypharmaceuticallyunapologeticallythermostaticallysurrealisticallyincontrovertiblythrombocytopeniaelectrochemistryinconceivabilityconversationallyneuropsychiatriccolorimetricallythermometricallyparamagneticallytrinitroglycerincommensurabilitymicrogametophytenoncompetitivelypolyphyleticallythermoplasticityimperfectibilityparapsychologiescommonsensicallyhypersusceptibleparasympatheticshyperviscositiesthrombocytopenicindiscernibilityhypophysectomies
...View all with 16 letters...
Phrases (407)
hypodermic needletympanic membranestrictly speakingfamily cyperaceaechristian huygensfamily cyprinidaewilliam wycherleycardiac glycosideefficiency expertchemical analysis
...View all with 16 letters...
Words (143)
counterinsurgencyunconventionalitybacteriologicallysuperconductivityparathyroidectomymaterialisticallycardiorespiratoryelectrostaticallythermodynamicallyinconsequentiallysocioeconomicallypsychotherapeuticinterdisciplinaryhyperreactivitiesself-contradictoryisoelectronicallyphysiotherapeuticcercidiphyllaceaeunexchangeabilitythermoperiodicitykaleidoscopicallyspectroscopicallythrombocytopeniaschlortetracyclinemonosyllabicitiespaternalisticallyhypophysectomizeshypophysectomisedarchitectonicallyferrimagneticallymorphogeneticallyhypophysectomizedcryopreservationslexicographicallycryptocrystalline
...View all with 17 letters...
Phrases (438)
mary leontyne pricesalvia leucophyllabalaena mysticetusczech monetary unitproteolytic enzymehypoglycemic agentcuban monetary unitlycopus americanustheological systemcapital of kentucky
...View all with 17 letters...
Words (66)
characteristicallyinconsequentialityhypercoagulabilityinterchangeabilityneuropsychologicalpolyesterificationspectroheliographypolyribonucleotidenoncomprehensivelypsychotherapeuticshypophysectomizinganthropocentricitycylindrical-stemmedlipopolysaccharidestereospecificallyimmunocytochemicalcalymmatobacteriumstoichiometricallyrecrystallizationscounterintuitivelymucopolysaccharidehypercholesteremiamagnetostrictivelyphenomenologicallygeochronologicallydehydrochlorinasesdehydrochlorinateddehydrochlorinatesneuroendocrinologytrichloroethylenesgranulocytopoiesesspectrographicallygranulocytopoiesisaerothermodynamicsneuropsychiatrists
...View all with 18 letters...
Phrases (413)
bombycilla cedroruneriobotrya japonicalachrymal secretionfreudian psychologypodilymbus podicepscolumbia universityclass schizomycetesread-only memory chipkilocycle per secondfamily trichechidae
...View all with 18 letters...
Words (57)
hydrochlorothiazidecinematographicallypolyesterificationsextralinguisticallypolyribonucleotideshypersusceptibilityparathyroidectomiesparthenogeneticallynonrelativisticallymucopolysaccharideslipopolysaccharidescytodifferentiationconceptualisticallycytopathogenicitiesimmunocytochemistrybacteriochlorophyllmagnetohydrodynamicphenomenalisticallyphenylthiocarbamidedehydrochlorinatingdehydrochlorinationphosphatidylcholinemercury-contaminatedinterconvertibilityelectromagneticallycontradistinctivelyelectromechanicallyinterferometricallyimpressionisticallyelectrophoreticallyelectrophysiologieselectrophysiologistdeoxyribonucleotideanthropocentricallyelectroretinography
...View all with 19 letters...
Phrases (374)
acetylsalicylic acidfamily cyclopteridaefamily cynoglossidaehydrastis canadensismillimeter of mercuryalpine type of glaciergiles lytton stracheyphytolacca americanafamily dasyproctidaegenus symphoricarpos
...View all with 19 letters...
Words (37)
counterrevolutionaryuncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolparathyroidectomizedhyperadrenocorticismcytodifferentiationsimmunocytochemicallymagnetofluiddynamicsbacteriochlorophyllsphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicselectrophysiologicalelectrophysiologistsdeoxyribonucleotidesmicrocrystallinitiesimmunohistochemistryroentgenographicallyencephalomyocarditischemotherapeuticallyhydrochlorothiazidespsychopharmacologiesmicrophotometricallysyncategorematicallyhypercholesterolemichypercoagulabilitieshyperconsciousnessesheterobasidiomycetes
...View all with 20 letters...
Phrases (324)
yellow-shafted flickerwyethia amplexicaulisorder mycelia steriliafamily phytolaccaceaeorder myxobacterialesfamily trachipteridaedivision tracheophytabalance sheet analysisclyde william tombaughfamily dermochelyidae
...View all with 20 letters...
Words (10)
hypersusceptibilitiesstereomicroscopicallyimmunocytochemistriesacetylcholinesteraseselectromyographicallydendrochronologicallyantiferromagneticallyhypercholesterolemiaspsychotherapeuticallytetrahydrocannabinolsPhrases (225)
icelandic monetary unitelectrolytic condenserhelichrysum bracteatumdesoxyribonucleic acidextrauterine pregnancybyzantine architectureeucalyptus fraxinoidescynoglossum officinalecapital of pennsylvaniacambodian monetary unit
...View all with 21 letters...
Words (5)
spectrophotometricallyintercomprehensibilityelectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (212)
lycopersicon esculentumhaliaeetus leucorhyphustrazodone hydrochloridefamily dendrocolaptidaeloyalist volunteer forcesubfamily bassariscidaerhythm and blues musiciancrescent city connectionmale reproductive systemnicaraguan monetary unit
...View all with 22 letters...
Words (4)
laryngotracheobronchitiselectrocardiographicallymicroelectrophoreticallyschizosaccharomycetaceaePhrases (113)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotamary wollstonecraft godwinunidentified flying objectprivately held corporationprimary sex characteristicsir terence mervyn rattiganbrassica oleracea botrytisdistinguished flying cross
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (86)
francis scott key fitzgeraldcentral intelligence agencymodest petrovich mussorgskypropoxyphene hydrochloridepolystichum acrostichoidesreligious society of friendscaulophyllum thalictroidespyotr alexeyevich kropotkinmichelson-morley experimentandrei arsenevich tarkovsky
...View all with 25 letters...
Phrases (66)
brassica oleracea gongylodeshunting and gathering societyhuman immunodeficiency virussecretary of veterans affairsemployee stock ownership planassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinasubdivision deuteromycotina
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (51)
american revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinco-operative republic of guyanacommissioned military officernuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joyce
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (44)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemfeodor mikhailovich dostoevsky
...View all with 28 letters...
Phrases (28)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeehydrangea macrophylla hortensisultrasonic pulse velocity tester
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (27)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynobsessive-compulsive personalitybachelor of arts in library sciencedepartment of energy intelligencedepository financial institutionethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndrome
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (17)
digital communications technology2019-ncov acute respiratory diseasetupac amaru revolutionary movementrevolutionary proletarian nucleusprimary subtractive color for lightrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontinternational intelligence agency
...View all with 31 letters...
Phrases (19)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateuniversity of california at berkeleyprimary subtractive colour for light
...View all with 32 letters...
Phrases (15)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapyinternational law enforcement agencycapital: critique of political economy
...View all with 33 letters...
Phrases (8)
jacques francois fromental elie halevychronic obstructive pulmonary diseaseacademy of television arts and sciencesdryopithecus rudapithecus hungaricusmassachusetts institute of technologyeinstein's special theory of relativitycomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (8)
angiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemtransportation security administrationsecretary of health education and welfaresocialist people's libyan arab jamahiriyaPhrases (12)
severe combined immunodeficiency diseaseuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausenus army criminal investigation laboratory
...View all with 37 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay