Words Containing: Y,E,L,K
(In Any Order)
There are 499 words,
601 phrases and
0 abbr's with
Y,E,L,K in.
Best Scoring Words With: Y,E,L,K
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
| freckly | 7 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| whelky | 6 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| kylikes | 7 | 18 | nounn | |||||
noun • An Ancient Greek drinking cup with a stem, two handles, and a broad, shallow body | ||||||||
| skylike | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| flecky | 6 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| feckly | 6 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
| keyhole | 7 | 17 | nounn | |||||
noun • the hole where a key is inserted | ||||||||
| flunkey | 7 | 17 | nounn | |||||
noun • a male servant (especially a footman) • a person of unquestioning obedience | ||||||||
| ivylike | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (39)
barkleyskylinekeyholeflunkeybeckleynakedlyfrecklykeylessbleaklylackeyskylikesivylikeskylikesleeklyeyelikeperkilyalkynespeskilybeyliksraylikekeypalsleakilyclerklykludgeytoylikejerkilyyolkierlekythikeylineyslakedboylikekayliedkylicesrokelaytockley
...View all with 7 letters...
Phrases (3)
egg yolkkey limekey palmWords (76)
unlikelyberkeleymckinleymalarkeykennellyladylikeyarmulkevalkyriewickedlyflyspeckmarkedlylatchkeyshockleybiweeklysneakilykilobyteblanketycheekilyhymnlikeflunkeysskylinesyokelessfreakilylekythuskaleyardbrokenlykeyholeslackeyedquaylikekielbasyflackeryrubylikeforkedlyyarmelkewheylike
...View all with 8 letters...
Phrases (8)
eye blinkmilk wheyholy weekkay boyleblack eyeallen keysilky elmlake eyreWords (93)
drunkenlykimberleyjaywalkerplaymakerleukocytejellylikehyperlinkcrookedlypuppylikesylphlikeberrylikewakefullyfairylikesyruplikeskylarkerirksomelywalkyriesankylosedberserklyyarmelkesyarmulkeskaleyardsrakehellyweakishlyleukotomylatchkeyslackeyingkilocyclejerkinglysketchilystreakilymalarkeysflyspecksivorylikeharpylike
...View all with 9 letters...
Phrases (17)
lake nyasalike crazyturkey legkeep relaymilk yieldlayer cakemyrtle oakgene kellyrelay linkvalley oak
...View all with 9 letters...
Words (68)
remarkablyblackberrymistakenlybricklayerrecklesslyfreakishlylawyerlikeunladylikelukewarmlycocksurelyskylarkersskylightedsneakinglyyokefellowskeletallystylebooksplaymakerscockeyedlyhyperlinksleukocytesleukocyticflyspeckedperikaryallymphokinekilocyclessemiweeklyfecklesslycherrylikejaywalkersnewsweeklykindlesslytracklayerkidneylikeyellowcakekeyloggers
...View all with 10 letters...
Phrases (35)
mary leakeymt. mckinleytalk turkeyisle of skyelady killerpoyang lakegrace kellysafety lockchunky heelflame tokay
...View all with 10 letters...
Words (66)
huckleberryhoneysuckleunspeakablyskulduggeryyellowknifehypokalemiahypokalemickinesiologysickeninglyskepticallytalkativelyoutspokenlyhyperlinkedflyspeckingyokefellowsbricklayerschimneylikealkalimetrylymphokinesfactorylikelickerishlytracklayerskaryologieskittenishlyfarkleberrykineticallythanklesslykleptocracychelyabinskpinnywinkleskuldudderysnakeblennycackleberryself-mockerymonkeygland
...View all with 11 letters...
Phrases (38)
louis leakeyglossy snakelike royaltybilly the kidpolicy makermackerel skyalkyl halideclosely knitemmett kellycelery stick
...View all with 11 letters...
Words (47)
skullduggerygobbledygookhyperkalemiaholidaymakerhyperlinkinghoneysucklesflickeringlycytoskeletonleukocytosiscytoskeletalunremarkablyleukocytosesdaydreamlikekremlinologyhypokalemiasbackhandedlykeratoplastyyellow-markedpinnywinklesknowledgablyhoneysuckledyankee-doodlerevokabilityfairnytickleleukocytoticblackish-greyalkylbenzenecockyleekiesgreyish-blackunprovokedlytiddledywinktiddleywinkspennywinklesalkalescencyladylikeness
...View all with 12 letters...
Phrases (36)
lickety splithockey clinichockey leaguealben barkleyblink of an eyealfred kinseyyellow jackettake kindly toliterary workjewelry maker
...View all with 12 letters...
Words (26)
marketabilityholidaymakerscytoskeletonsknowledgeablyphytoplanktergobbledygookstiddledywinkskindheartedlykinematicallyhe-huckleberryblackberryingfairnyticklesclickety-clackclickety-clickblockheadedlyjawbreakinglyklyuchevskayaremarkabilityheartbrokenlyunmistakeablydusky-colouredpoikilothermysketchabilityforeknowinglyprickly-leafedprickly-leavedPhrases (45)
el iskandriyahyakut languagemount mckinleyjekyll and hydenorfolk wherryrichard leakeyblack mulberrywhiskey bottlesilky wisteriakillarney fern
...View all with 13 letters...
Words (16)
leukodystrophyphytoplanktersankylosaurusesbreathtakinglyearthshakinglycantankerouslyacknowledgedlyhydrokineticalleukocytosisesblackberry-lilyblackberryingsvelvety-skinnedhuckleberryingyekaterinoslavladylikenessesdiphenylketonePhrases (60)
dimethyl ketonedrunken revelryveliky novgorodcapital of kenyablackberry bushskeletal systemblended whiskeyold world monkeyemily dickinsonkyrgyz republic
...View all with 14 letters...
Words (14)
heartbreakinglykinestheticallyankylostomiasesphenylketonuriccholecystokinintelekineticallyphenylketonuriabrokenheartedlyknowledgabilitykenogeneticallyacknowledgeablylymphoblast-likehuckleberryingsdiphenylketonesPhrases (46)
erlenmeyer flaskcapital of turkeyalfred korzybskinetwork topologysecurity blanketwilliam mckinleymarketable yieldwilliam shockleygenus myxinikelafield hockey ball
...View all with 15 letters...
Words (6)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricscholecystokininsknowledgeabilityPhrases (47)
strictly speakinghypophyseal stalkcapital of new yorkfriendly takeoverfamily gekkonidaeelwyn brooks whitetrackless trolleycoral honeysuckleryukyuan languagecomstock mealybug
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (26)
aleksandr solzhenitsynsri lankan monetary unitisle royal national parkjohn fitzgerald kennedythomas kennerly wolfe jr.schlumbergera buckleyimusculoskeletal systemthin-leaved stringybarkketamine hydrochloridepeter ilich tchaikovsky
...View all with 21 letters...
Phrases (11)
francis scott key fitzgeraldtrans-alaska pipeline systempyotr alexeyevich kropotkinmelville louis kossuth deweycygnus columbianus bewickiialeksey maksimovich peshkovmikhail yurievich lermontovchronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russell
...View all with 25 letters...
Phrases (10)
holy roman emperor frederick iialeksandr sergeyevich pushkinfalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventorymartin luther king jr's birthdaykepler's law of planetary motionPhrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
