Words Containing: Y,E,A,H,S
(In Any Order)
There are 1,945 words,
1,916 phrases and
0 abbr's with
Y,E,A,H,S in.
Best Scoring Words With: Y,E,A,H,S
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| hyraxes | 7 | 20 | nounn | |||||
noun • any of several small ungulate mammals of Africa and Asia with rodent-like incisors and feet with hooflike toes | ||||||||
| hawkeys | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| mayhems | 7 | 17 | nounn | |||||
noun • the willful and unlawful crippling or mutilation of another person • violent and needless disturbance | ||||||||
| heydays | 7 | 17 | nounn | |||||
noun • the period of greatest prosperity or productivity | ||||||||
| yeshiva | 7 | 16 | noun, adjectiven, adj | |||||
noun • an academy for the advanced study of Jewish texts (primarily the Talmud) | ||||||||
| eyewash | 7 | 16 | nounn | |||||
noun • lotion consisting of a solution used as a cleanser for the eyes | ||||||||
| shapely | 7 | 15 | adjectiveadj | |||||
adjective • having a well-proportioned and pleasing shape | ||||||||
| hyraces | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| hayseed | 7 | 14 | noun, adjectiven, adj | |||||
noun • a person who is not very intelligent or interested in culture | ||||||||
| hydrase | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (61)
hysteriastracheystealthyshenyangamethystheavysethoarselysydenhamthessalyeyeshadechastelyyeshivahscyphatesashayedyachtershyalineseuphrasyshanteyshydrateshayseedsyeshivashomestaychayotescharleyshackneysabhenryschanteysheadwayshyalitesphytanesheadstayshamoyedhearsayslehayimshydrases
...View all with 8 letters...
Phrases (4)
sea nymphbaby shoesea hollysegway htWords (117)
hairstyleblasphemypantyhoseplayhouseemphysemahorseplayseaworthyanywhereshesitancyaeschylussisypheanunshapelyeyeshadowoverhastyhymenealspaycheckshydrolaseyachtsmenkaffiyehshysteriaslechayimserythemasapophysesshantymenkeffiyahseyeshadesbeamishlyanchyloseabashedlyhaplesslyweakishlylatchkeysethylatespyorrheasisohyetal
...View all with 9 letters...
Phrases (16)
ready cashheavy sparhair stylespeech daysay hey kidgenus hylapaul heysestay freshchase awaymushy peas
...View all with 9 letters...
Words (199)
hystericalhyperspacesympathizesleepyheadhandsomelystealthilysympathiselachrymosesoothsayerfreakishlyplayhousesasphyxiateshamefullyharmlesslymetaphysicepiphysealepiphysialhaemolysismyastheniahesitantlylengthwayssaprophyteholidayersdehydratescheapishlygynarchiessympathiescoryphaeusrehydrateshalophyteshairstylesshrievaltyaerophyteshydrangeasmythmakers
...View all with 10 letters...
Phrases (39)
moshe dayangenus khayaheavy swellgenus physahenry jameshouse partybasil thymelawyer bushgenus typhahelen hayes
...View all with 10 letters...
Words (243)
sympatheticshamelesslymetaphysicshorseplayerbathyspheresynesthesiaasphyxiatedsympathizersphericallyschenectadyunabashedlyphraseologypsychedeliageophysicalunashamedlysympathisersympathisedheartlesslysqueamishlybreathalysescenographyhyperplasiaeschatologystenographyhypophysealfaithlesslyphagocytosemisshapenlyhoneyeatersdeathlesslydehydratorspolychaetessympathizesshapelesslyhydroplanes
...View all with 11 letters...
Phrases (36)
mary shelleysensory hairsouth by easteast by southanise hyssopchess playergenus hyaenajoseph haydnwhiskey neatship's galley
...View all with 11 letters...
Words (300)
metaphysicalhystericallypsychobabblebreathlesslypraiseworthychrestomathypsychoactivepsychosexualerythematoushaberdasherysuperhighwayexhaustivelybreathalyserhypnotisabledysmenorrheatracheostomysynaesthesiaestheticallyhesitatinglysuperhumanlystonyheartedphysicalnessphagocytosedphagocytosesfarsightedlyoropharyngeshyperkinesiamethylaminesunhystericalmethylationsshamefacedlyhemihydratesseraphicallysympathizershyperplasias
...View all with 12 letters...
Phrases (59)
phantasy lifebarbary sheepgenus halcyonmass hysteriashetland ponyhawkeye stategenus sphyrnahylobates largenus coryphaaldous huxley
...View all with 12 letters...
Words (271)
homosexualitychrysanthemumpsychotherapyphysiotherapyunsympatheticaestheticallypsychoanalyzedehydrogenasesympathectomyhydrocephalussyntheticallytreacherouslypyrophosphatesoutheasterlypsychoanalysenortheasterlyinexhaustiblysaccharomycesoystercatcherbrachypterousperishabilityhyaluronidasespermatophyteholidaymakerssoftheartedlyphosphorylatehypothecatorslymphadenitishypocalcemiasphysiographerhymenopteranspolycythemiasgeophysicallyhyperacuitiesyellowthroats
...View all with 13 letters...
Phrases (84)
harvey cushingel iskandriyahshammy leathergenus nymphaeasunday clothesmexican hyssopthree kings' daygenus pyrrhulahorse-and-buggyhouse of prayer
...View all with 13 letters...
Words (242)
thermodynamicsmetaphysicallynarcosynthesisphosphorylatedplethysmographhydrotherapistanesthesiologyunhesitatinglypraiseworthilypachydermatousstretchabilityphosphorylatesaminophyllineshypermasculinedehydrogenaseshypermetropiaspsychoanalysespsychoanalyzedpsychoanalyzesmetaphysiciansoystercatcherspyrimethamineshedonisticallyhyperrealisticphytoplanktershyperawarenesscryptographersparenchymatouspseudepigraphydiphenylaminesspermatophytesspermatophyticplatyhelminthsplethysmogramshyperesthesias
...View all with 14 letters...
Phrases (101)
anthony burgessblackberry bushchinese parsleyjapanese cherrygenus chrysaorahenry cavendisherythema solareartillery shellgenus sphyraenaphysical change
...View all with 14 letters...
Words (199)
psychotherapistanaesthesiologyphysiotherapistheterosexualitysympathomimeticsympatheticallyeuphemisticallyneuropsychiatryimperishabilitykinestheticallyadenohypophysispsychedelicallymethylxanthinespolysaccharidesdisenchantinglydishearteninglyhyperaggressivehypersalivationpsychometriciancyproheptadineshyperstimulatedhyperstimulatessaccharomycetessophisticatedlyhypervigilanceshyperfastidiousionosphericallyphosphorylativepsychosexualityhyperinflationshypnotherapistshyperlipidemiashypermetabolismmethoxyfluranesatmospherically
...View all with 15 letters...
Phrases (147)
dialysis machinemrs. humphrey wardwystan hugh audenhyoscyamus nigerspiny-headed wormscholarly personarachis hypogaeajemaah islamiyahmythical monsterlymphatic vessel
...View all with 15 letters...
Words (99)
enthusiasticallysphygmomanometererythroblastosisthermostaticallyneuropsychiatrichypersalivationsinextinguishablyhypersexualitiesinexhaustibilitythermoplasticityhyperstimulatinghyperstimulationparapsychologiesparasympatheticsapocryphalnesseshypervitaminosessphygmomanometryglossopharyngealarchaeoastronomymonotheisticallyarchiepiscopallystenographicallystereophonicallycyanoethylationscyclohexylaminesperiphrasticallycyclophosphamidecaryophyllaceouskinaestheticallylymphangiectasialymphangiectasisecophysiologicalphenylketonuriasneurasthenicallyheavyheartedness
...View all with 16 letters...
Phrases (151)
christian huygensgenus crotaphytuschemical analysishypophyseal stalkacross the countrynevil shute norwaymechanical systempharyngeal tonsilrheims-douay biblegenus phytelephas
...View all with 16 letters...
Words (55)
psychotherapeutichyperreactivitiesphysiotherapeuticparaformaldehydeshyperstimulationshyperventilationssphygmomanometershypnotizabilitiesthrombocytopeniaspathophysiologieshyposensitizationencephalomyelitiscrystallographerscrystallographieslymphadenopathiescyclophosphamidesbathythermographsphenylethylaminesstereophotographypheochromocytomasdehydrochlorinaseglossopharyngealsorthopsychiatriestriphenylmethanesphosphoglyceratesneuropsychiatriesneuropsychiatristunsympatheticallymesembryanthemumsmetapsychologicalsuperheavyweightsdesynchronisationdesynchronizationdephosphorylatingdephosphorylation
...View all with 17 letters...
Phrases (182)
salvia leucophyllainterstate highwayclass rhodophyceaegenus symphalangustheological systemprimary censorshippetasites hybriduspython reticulatusgenus haematoxylongenus haematoxylum
...View all with 17 letters...
Words (45)
characteristicallyhyperaldosteronismneuropsychologicalhypersensitizationpolymorphonuclearsspectroheliographypsychotherapeuticssphygmomanometrieshyposensitizationslipopolysaccharidelymphangiographiesstoichiometricallypteridospermaphytamucopolysaccharidehypercholesteremiasaccharomycetaceaedehydrochlorinasesdehydrochlorinatesspectrographicallyaerothermodynamicsneuropsychiatristselectromyographiesdemythologizationsheavyheartednessesmethylnaphthalenespachycephalosaurusdephosphorylationshomobasidiomycetespseudoparenchymatachlortetracyclineshydrometallurgistsphotosyntheticallycytoarchitectonicshydroxytryptamineshyperalimentations
...View all with 18 letters...
Phrases (180)
family physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyclass schizomycetesantipsychotic agentgenus chamaecytisusshort-term liabilityarchitectural stylecrataegus oxycantha
...View all with 18 letters...
Words (28)
hyperparathyroidismhypersensitizationsparathyroidectomiesmucopolysaccharideslipopolysaccharidescytopathogenicitiesphenomenalisticallyphosphatidylcholinephosphoenolpyruvatethird-dimensionalityhysterosalpingogramthree-dimensionalitymethylcholanthrenesencephalomyelitidesparasympathomimeticdiethylcarbamazinesphytohemagglutininshyperconcentrationstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminepsychotomimeticallyhyperemotionalitiesdimethyltryptamineshyperexcitabilitiesexhibitionisticallyhyperirritabilitiesschizosaccharomycesPhrases (159)
hydrastis canadensisgiles lytton stracheygenus cryptobranchusgenus symphoricarposavogadro's hypothesischinese monetary unithydrobates pelagicusuniversity of chicagosymphytum officinalesubfamily mephitinae
...View all with 19 letters...
Words (26)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallyhyperadrenocorticismlymphogranulomatosesbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicselectrophysiologicalencephalomyocarditispseudoparenchymatoushydrochlorothiazidespsychopharmacologieshypercoagulabilitiesdimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsPhrases (142)
yellow-shafted flickerwyethia amplexicaulisbalaenoptera physalusdivision tracheophytabalance sheet analysismechanically skillfulmilton snavely hersheyeucalyptus calophyllalophodytes cucullatusfriendly relationship
...View all with 20 letters...
Words (6)
acetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologieshypercholesterolemiaspsychotherapeuticallytetrahydrocannabinolsPhrases (124)
aleksandr solzhenitsynhelichrysum bracteatumparty to the transactionstrawberry haemangiomaptolemy ii philadelphushenry hobson richardsonagricultural chemistryhans holbein the youngersyngnathus hildebrandiphylum platyhelminthes
...View all with 21 letters...
Words (5)
spectrophotometricallyphosphoglyceraldehydescarboxymethylcelluloseelectrophysiologicallyencephalomyocarditisesPhrases (100)
haliaeetus leucorhyphusaleksandr i. solzhenitsynaccessory before the factsodium tripolyphosphaterhythm and blues musicianathyrium thelypteroidesfamily branchiostomidaeatmospheric electricitysphyrapicus varius ruberhenry engelhard steinway
...View all with 22 letters...
Words (2)
carboxymethylcelluloseshexamethylenetetraminesPhrases (75)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphytasearch and destroy mission
...View all with 23 letters...
Words (3)
laryngotracheobronchitisphosphatidylethanolamineschizosaccharomycetaceaePhrases (64)
argyroxiphium sandwicensedivision heterokontophytasubphylum cephalochordataprimary sex characteristicexistentialist philosophytechnology administrationhypersensitivity reactionhenry wadsworth longfellowsir charles leonard woolleychrysosplenium americanum
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (53)
embryonal rhabdomyosarcomamary wollstonecraft shelleypolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidessir arthur stanley eddingtonandrei arsenevich tarkovskysudden infant death syndromeanthony charles lynton blair
...View all with 25 letters...
Phrases (41)
hunting and gathering societyhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Phrases (35)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (25)
aleksandr feodorovich kerenskyephippiorhynchus senegalensismarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoysodium carboxymethyl cellulose
...View all with 28 letters...
Phrases (14)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisonarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristicalfred habdank skarbek korzybskifeodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (15)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencewaterhouse-friderichsen syndromemucocutaneous lymph node syndromehenri rene albert guy de maupassanttechnical analysis of stock trendsfamily schizosaccharomycetaceaeprovisional irish republican army
...View all with 30 letters...
Phrases (15)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (1)
respiratory distress syndrome of the newborn
