Words Containing: Y,A,N,G,S
(In Any Order)
There are 1,098 words,
1,443 phrases and
0 abbr's with
Y,A,N,G,S in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
syngamy | 7 | 16 | nounn | |||||
noun • The fusion of two gametes to form a zygote. | ||||||||
swaying | 7 | 14 | verb, adjectivev, adj | |||||
noun • controlling influence • pitching dangerously to one side verb • move back and forth or sideways • move or walk in a swinging or swaying manner • win approval or support for • cause to move back and forth | ||||||||
hayings | 7 | 14 | ||||||
noun • the harvesting of hay • the season for cutting and drying and storing grass as fodder | ||||||||
gymnast | 7 | 13 | nounn | |||||
noun • an athlete who is skilled in gymnastics | ||||||||
spaying | 7 | 13 | verb, nounv, n | |||||
noun • neutering a female by removing the ovaries | ||||||||
spangly | 7 | 13 | adjectiveadj | |||||
adjective satellite • covered with beads or jewels or sequins | ||||||||
syntagm | 7 | 13 | nounn | |||||
noun • a syntactic string of words that forms a part of some larger syntactic unit | ||||||||
glycans | 7 | 13 | ||||||
noun • (cabrohydrate) Any polysaccharide or oligosaccharide, especially one that is part of a glycoprotein or glycolipid. | ||||||||
mayings | 7 | 13 | ||||||
Valid word for Scrabble US
| ||||||||
synagog | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
yangsWords (74)
sprayingstingraystrayingshenyanglongwaysgraynesssyntagmagainsaysgymnastssplayingslangilyunsayinggangwayssyringasyeastingsynergiasavinglyresayingsyngamicfrayingsessayingsallyingassayinggymnasiayawpingsgunplayslangsyneyealingssignallysyngasesgypseiansavvyingsynagogslangleyspalsying
...View all with 8 letters...
Phrases (4)
sign awaygenus myalang synespray gunWords (137)
strangelysynagoguegymnasiummoneybagsanalysingeasygoinggymnasticbypassingsparinglynystagmusamusinglysteadyinggunnysacksignatorydashinglydismayingteasinglydayspringstagnancyraspinglyastonyinggunnybagsoxygenaseyeanlingssoaringlyyearningsnongreasysyngamoussubagencylastinglyegyptiansamylogensshammyinganisogamylayerings
...View all with 9 letters...
Phrases (8)
gunny sackgenus nypaeasy goinggenus hylagenus bryabandy legsgenus hoyaring-a-rosyWords (146)
satisfyinggymnasticsscathinglysingularlyfalsifyinggastronomylaryngitisparalysingsmashinglygymnasiumspleasinglyspankinglycrashinglyfantasyingsanguinarysanguinityslantinglylengthwayspanegyristandrogynesgynandrousgynarchiesautopsyingmisplayingpanegyricsamnestyingsneakinglydisplayinghydrangeasgyrfalconsquarryingscanyoningsresprayingsanguinelywayfarings
...View all with 10 letters...
Phrases (29)
yves tanguygenus khayagenus cycassugar candygenus physagenus caryapenny grassgenus typhain a pig's eyesam goldwyn
...View all with 10 letters...
Words (148)
babysittingdangerouslysingularityyugoslavianandrogynousunceasinglyangioplastyclassifyinggrandiosityunsparinglysoothsayingdisarminglyravishinglysuperagencytypecastingscenographyscreaminglystartlinglystenographygrandioselycosignatorysanctifyingoverstayingsyndicatingcaressinglysaponifyingphantasyingpanegyristsbioassayingmisapplyingsearchinglyabsorbinglydismayinglyarrestinglyvanishingly
...View all with 11 letters...
Phrases (56)
genus lycosalaying wastegenus styraxglossy snakegenus zoysiathymus glandsan diego baygenus ostryaming dynastygenus hyaena
...View all with 11 letters...
Words (148)
increasinglyunsatisfyingungraciouslystaggeringlydespairinglyhypogonadismlaryngoscopecontagiouslylaryngoscopyreassuringlyasphyxiatingastoundinglynauseatinglysympathisingtransmogrifyhesitatinglysurpassinglysatisfyinglymisleadinglymoneymakingsgranulocytesgerrymandersoropharyngesplasmolyzingoxygenationspugnaciouslylanguorouslysympathizingdeoxygenatesdesolatinglyclangorouslygeosynclinalmerrymakingssanguinarilybricklayings
...View all with 12 letters...
Phrases (79)
staying powershaking palsygenus syringagenus cydoniagenus apteryxgenus tayassugenus halcyongalveston baygenus eucaryacasey stengel
...View all with 12 letters...
Words (140)
significantlygynaecologistastonishinglyeverlastinglypainstakinglydehydrogenasedisparaginglymeaninglesslycrystallizingfascinatinglynostalgicallynightmarishlyoutstandinglymagnanimouslygeostationarydisqualifyingadmonishinglyunambiguouslytantalisinglyconsanguinityphagocytosinggymnasticallyreclassifyingdeclassifyingsystematisingsuffocatinglysystematizingfrustratinglydissatisfyingsaprogenicityinsinuatinglysaccharifyingsyllabicatingproteoglycansstoryboarding
...View all with 13 letters...
Phrases (104)
harvey cushingcygnus atratuswaste of energygenus bradypusgenus cyclamengenus gypaetusgenus acinonyxsalivary glandgenus martyniagenus nymphaea
...View all with 13 letters...
Words (109)
embarrassinglylinguisticallydiagnosticallyanesthesiologydisapprovinglyunhesitatinglyadvantageouslyinsignificancydiscouraginglydehydrogenasesdisquantityingmisclassifyingexasperatinglyintransigentlystagflationaryplaywrightingsearthshakinglysubclassifyingjingoisticallyestrogenicallydehydrogenatesorganismicallygynandromorphsphysiognomicalsyringomyeliasdeoxygenationsvaingloriouslymucilaginouslyphytopathogenshypomagnesemiapeptidoglycansglycosylationslysogenizationlaryngectomeeseugeosynclinal
...View all with 14 letters...
Phrases (110)
anthony burgessigor stravinskydrainage systemmargin of safetygenus chrysaoragenus aepycerosanser cygnoidesgustatory organgenus fagopyrumpac-man strategy
...View all with 14 letters...
Words (78)
anaesthesiologysynergisticallydisappointinglyrecrystallizingtransmogrifyinggastronomicallyultrasonographyagranulocytosiscommiseratinglypsychoanalyzingdisenchantinglydishearteninglydistinguishablyoverclassifyinghypervigilancesresystematizingphosphorylatingagranulocytosesunderstandinglylymphangiogramseasygoingnessespsychogenicallycongressionallysemipornographyhypomagnesemiasinsignificantlycrossopterygianlysogenizationsintransigeantlycounterstrategypseudopregnancyhymenogastralesrecrystallisingcircumgyrationsenergy-absorbing
...View all with 15 letters...
Phrases (150)
syringa vulgarisasamiya languagewystan hugh audengenus sylvilagusgenus bombycillahyoscyamus nigergenus cyanocittamask of pregnancydoris may lessinggenus eriobotrya
...View all with 15 letters...
Words (31)
sphygmomanometerinextinguishablyotolaryngologisthyperstimulatingsphygmomanometryglossopharyngealnonpsychologicalcrossopterygianslyginopteridalesstenographicallyflabbergastinglynonsignificantlygastroenterologylymphogranulomasstrongyloidiasesstrongyloidiasislymphangiectasialymphangiectasisconsanguineouslysyncategorematicdehydrogenationsotolaryngologiesgynandromorphiesgynandromorphismantagonisticallyinterstratifyingphysiognomicallyevangelisticallygymnospermophytagynandromorphousdiscriminatinglyPhrases (126)
strictly speakingchristian huygenscygnus buccinatorgenus crotaphytusbluegrass countrysugar ray robinsongenus aptenodytesisland of guernseyorder polygonalespharyngeal tonsil
...View all with 16 letters...
Words (11)
sphygmomanometersgastroenterostomysamoyedic-speakingglossopharyngealsglycosaminoglycanotolaryngologistsdisadvantageouslygynandromorphismsdephosphorylatingdemythologisationindistinguishablyPhrases (121)
interstate highwaypearly everlastinggenus symphalangusmalaysian languageantipsychotic drugtypha angustifoliayeniseian languagecrataegus monogynagenus haematoxylongenus haematoxylum
...View all with 17 letters...
Words (17)
neuropsychologicalsphygmomanometrieslaryngopharyngitislymphangiographiesdistinguishabilitymagnetostrictivelyglycosaminoglycansgranulocytopoiesesgranulocytopoiesisdemythologizationspropagandisticallyrhinolaryngologistsedimentologicallyindiscriminatinglydihydroergotaminesneurophysiologicalhyperpigmentationsPhrases (130)
freudian psychologygenus styracosaurusnavigational systemantipsychotic agentmegacycle per secondgenus chamaecytisuscrataegus oxycanthawedding anniversarygenus archaeopteryxgenus phyllostachys
...View all with 18 letters...
Words (7)
extralinguisticallycrosslinguisticallycytopathogenicitieshysterosalpingogramcross-linguisticallyphytohemagglutininssociolinguisticallyPhrases (89)
family cynoglossidaegiles lytton stracheygenus cryptobranchusgenus symphoricarposcapital of kyrgyzstansalicylate poisoninguniversity of chicagocrataegus oxyacanthaunix operating systemgossypium peruvianum
...View all with 19 letters...
Words (9)
indistinguishabilitylymphogranulomatoseslymphogranulomatosismagnetofluiddynamicsoophorosalpingectomyneurophysiologicallymagnetohydrodynamicssyncategorematicallypalatopharyngoplastyPhrases (82)
oryctolagus cuniculusbyelorussian languageclassifying adjectiveluscinia megarhynchosa-scan ultrasonographyaustralian bonytonguegenus campylorhynchuspass with flying colorsbasidiomycetous fungisaturday night special
...View all with 20 letters...
Words (2)
otorhinolaryngologistotorhinolaryngologiesPhrases (55)
igor ivanovich sikorskycynoglossum officinaleginglymostoma cirratumstrawberry haemangiomasoren aabye kierkegaardhans holbein the youngersyngnathus hildebrandiorder lyginopteridalesphysostegia virginianabottom fermenting yeast
...View all with 21 letters...
Words (1)
otorhinolaryngologistsPhrases (60)
amygdalus communis amarahenry engelhard steinwaysamuel pierpoint langleydisplaying incompetencenotemigonus crysoleucasbahasa malaysia languagesir george otto trevelyangymnogyps californianusharvery williams cushingbarbados-gooseberry vine
...View all with 22 letters...
Words (1)
laryngotracheobronchitisPhrases (37)
carnegie mellon universityargyroxiphium sandwicensemary wollstonecraft godwinsir terence mervyn rattigantechnology administrationhenry wadsworth longfellowpaul johann ludwig von heyseposterior meningeal arterydivision gymnospermophytasubdivision ginkgophytina
...View all with 24 letters...
Words (1)
uvulopalatopharyngoplastyPhrases (23)
igor fyodorovich stravinskydiamond wedding anniversaryfrancis scott key fitzgeraldbeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating systemarab revolutionary brigadespodkamennaya tunguska rivercygnus columbianus bewickiisuperorder acanthopterygii
...View all with 25 letters...
Phrases (24)
brassica oleracea gongylodeshunting and gathering societysubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsubdivision mastigomycotinasystem of weights and measuresbenign prostatic hyperplasiamyrtillocactus geometrizans
...View all with 26 letters...
Phrases (19)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore puginnuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoinformation processing system
...View all with 27 letters...
Phrases (15)
revolutionary people's struggleephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguecygnus columbianus columbianusimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormonemilitary intelligence section 5
...View all with 28 letters...
Phrases (10)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnonsteroidal anti-inflammatory drugoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united statesbosnian-herzegovinian monetary unitcystic fibrosis transport regulatorPhrases (8)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systempositron emission tomography scannerunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay