Words Containing: Y,A,K
(In Any Order)
There are 1,200 words,
1,047 phrases and
0 abbr's with
Y,A,K in.
Best Scoring Words With: Y,A,K
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| skyjack | 7 | 27 | verbv | |||||
verb • subject an aircraft to air piracy | ||||||||
| jaywalk | 7 | 24 | verb, adverbv, adv | |||||
verb • cross the road at a red light | ||||||||
| quacky | 6 | 24 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| squeaky | 7 | 23 | adjectiveadj | |||||
adjective satellite • having or making a high-pitched sound such as that made by a mouse or a rusty hinge | ||||||||
| quakily | 7 | 23 | ||||||
Valid word for Scrabble US
| ||||||||
| kyanize | 7 | 23 | verbv | |||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
| yakuza | 6 | 22 | nounn | |||||
noun • a Japanese gangster • organized crime in Japan; an alliance of criminal organizations and illegal enterprises | ||||||||
| jacky | 5 | 21 | verb, noun, adjectivev, n, adj | |||||
noun • A sailor. • English gin. | ||||||||
| whacky | 6 | 21 | adjectiveadj | |||||
adjective satellite • ludicrous, foolish • informal or slang terms for mentally irregular | ||||||||
| haycock | 7 | 21 | nounn | |||||
noun • a small cone-shaped pile of hay that has been left in the field until it is dry enough to carry to the hayrick | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (151)
franklypaybacksqueakystarkeybarkleysparklyyakkingparkwayweekdaywalkwaypanickyhackneyblanklyskylarkkeycardworkdayshakilyskywardspasskypasskeysickbayhaycockskywalkkatydidstreakynakedlystarklyjaywalkcracklybuybackhackeryknaveryvandykeskagwayblackly
...View all with 7 letters...
Phrases (21)
pay backeye maskbuy backday bookde bakeykey palmsick payeye bankwork dayyolk sac
...View all with 7 letters...
Words (205)
backyardkeyboardpaycheckyearbookjunkyardhaystackdaybreakyokohamaplaybackplaybookweekdaysmalarkeyladyliketakeawayyarmulkeworkadaysukiyakivalkyrieteriyakirockawaylackadayyarmulkamarkedlylatchkeywalkawayquackerysneakilygarlickydockyardkazatskyswaybackrakishlyblanketyskywardshaymaker
...View all with 8 letters...
Phrases (33)
baby talklock awaythank youblack flyeasy markplay backyack awayyak's milkcooky jarkay boyle
...View all with 8 letters...
Words (202)
speakeasypiggybackreykjavikawkwardlybreakawaytarkovskykeynesianyardstickjaywalkerplaymakercockamamythackerayhackneyedgunnysackstockyardkandinskyhaymakingjayhawkerbuckyballankylosisalackadaykaryotypehackberrybrickyardmawkishlyknavishlyfancyworkeukaryotepaychecksquakinglywakefullyfairylikeperikaryabackstorykaffiyehs
...View all with 9 letters...
Phrases (55)
lake nyasalike crazyjockey capgunny sackpay packetkeep relaywork partyrock hyraxsay hey kidmake happy
...View all with 9 letters...
Words (170)
bankruptcyremarkablythankfullyblackberrymistakenlyskyscraperbricklayerstravinskypaddywhackmoneymakerfreakishlyrockabillyeukaryoticlawyerlikespankinglyunshakablylikabilityunladylikepickaninnyprayerbookalkalinitydyskinesiaankylosaurmerrymakerlukewarmlyplaymakinggraywackesprankishlykanamycinspiggybacksbackwardlyskylarkerscarrybackssneakinglyskeletally
...View all with 10 letters...
Phrases (77)
mary leakeymaxim gorkygenus khayaprayer bookkuwait citytalk turkeyyard markerpastry cookkey patternalkyl group
...View all with 10 letters...
Words (116)
hypermarkettchaikovskybaryshnikovunspeakablyhypokalemiahypokalemicjabberwockykeyboardistbricklayingmoneymakingmerrymakingkinyarwandaskepticallyworkabilityyastrzemskiunthinkablytalkativelythankworthypiggybackedbankabilityskyscrapersprokaryotesbricklayerskaryogamiesalkylationskeyboardingplaymakingsmoneymakersbradykininsdyskinesiasrekeyboardsgimcrackerypaddywackedalkalimetrystringybark
...View all with 11 letters...
Phrases (68)
louis leakeyhockey coachglossy snakelike royaltypolicy makermackerel skykeep an eye onalkyl halideback countryfunny remark
...View all with 11 letters...
Words (75)
unmistakablystanislavskyhyperkalemiaankylosaurusholidaymakermoneymakingshyperkinesiaheterokaryonmerrymakingsbricklayingskaryokinetichydrocrackedkeyboardistscytoskeletalunremarkablyrekeyboardedhypermarketspaddywackingstringybarksblackguardlydaydreamlikepiggybackingkymographiesdrinkabilityhypokalemiastracklayingskaryokineseskaryologicalbackhandedlykaryokinesishydrocrackerkeratoplastykeyboardingsyellow-markedgallygaskins
...View all with 12 letters...
Phrases (90)
backspace keyshaking palsyhockey leaguealkyl radicalginkgo familyboris spasskyalben barkleybuckeye statea. noam chomskystock company
...View all with 12 letters...
Words (45)
painstakinglymarketabilityphytoplanktonholidaymakersknowledgeablyrekeyboardingunworkabilitymountebankeryphytoplankterhyperkinesiasheterokaryonsmegakaryocytehydrocrackingunknowabilitykindheartedlykinematicallyhydrocrackersthankworthilybradykinesiasstickybeakingblackberryingfairnyticklesclickety-clackblockheadedlyjawbreakinglyginkgophytinaklyuchevskayacryoplanktonsremarkabilitydostoyevskianknickknackeryheartbrokenlyunmistakeablyankyloglossiahydraulicking
...View all with 13 letters...
Phrases (75)
el iskandriyahyakut languagejekyll and hydeturkey buzzardfactory workercocktail partynook and crannydorothy parkerthree kings' daydiospyros kaki
...View all with 13 letters...
Words (26)
unthinkabilityhyperkeratoticphytoplanktersankylosauruseskaryotypicallybreathtakinglyhyperkeratoseshyperkeratosisearthshakinglyheterokaryosesheterokaryosisheterokaryoticcantankerouslymegakaryocyticacknowledgedlymegakaryocytesphytoplanktonshydrocrackingshydrokineticalblackberry-lilyblackberryingsyekaterinoslavladylikenessesrimsky-korsakovkinematographybrachypinakoidPhrases (90)
anthony van dyckanthony vandykeigor stravinskyemergency brakecapital of kenyablackberry bushskeletal systemdynamic speakerkeynote addressstrawberry mark
...View all with 14 letters...
Words (15)
lackadaisicallyheartbreakinglykinestheticallyankylostomiasesankylostomiasistelekineticallyphytoplanktonicphenylketonuriabrokenheartedlyknowledgabilitycockneyficationkenogeneticallyacknowledgeablylymphoblast-likebrachypinakoidsPhrases (81)
erlenmeyer flaskmask of pregnancybuckthorn familycapital of turkeydocking facilityalfred korzybskisecurity blanketandrei tarkovskymonkey-bread treewilliam mckinley
...View all with 15 letters...
Words (6)
heterokontophytakinaestheticallyphenylketonuriasheterokaryosiseskrypterophaneronknowledgeabilityPhrases (65)
strictly speakinghypophyseal stalkalan lloyd hodgkincock-and-bull storycapital of new yorkfriendly takeoverfrank lloyd wrightfamily gekkonidaeassyrian akkadiantrackless trolley
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (37)
nikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynsri lankan monetary unitisle royal national parksoren aabye kierkegaardpakistani monetary unitjohn fitzgerald kennedythomas kennerly wolfe jr.schlumbergera buckleyi
...View all with 21 letters...
Phrases (16)
louis seymour bazett leakeydivision heterokontophytaandrei andreyevich gromykosubdivision ginkgophytinaaleksey maximovich peshkovfrancis henry compton crickpartiya karkeran kurdistananatoli yevgenevich karpovarcuate artery of the kidneylucy in the sky with diamonds
...View all with 24 letters...
Phrases (18)
igor fyodorovich stravinskyfrancis scott key fitzgeraldtrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskypodkamennaya tunguska rivercygnus columbianus bewickiialeksey maksimovich peshkovmikhail yurievich lermontovchamaecyparis nootkatensis
...View all with 25 letters...
Phrases (12)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkintaras grigoryevich shevchenkofalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventory
...View all with 27 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay
