Words Containing: Y,A,H
(In Any Order)
There are 6,733 words,
4,085 phrases and
2 abbr's with
Y,A,H in.
Best Scoring Words With: Y,A,H
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
asphyxy | 7 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
cachexy | 7 | 24 | nounn | |||||
noun • any general reduction in vitality and strength of body and mind resulting from a debilitating chronic disease | ||||||||
hypoxia | 7 | 22 | nounn | |||||
noun • oxygen deficiency causing a very strong drive to correct the deficiency | ||||||||
squashy | 7 | 22 | adjectiveadj | |||||
adjective satellite • like a pulp or overripe; not having stiffness • (of soil) soft and watery • easily squashed; resembling a sponge in having soft porous texture and compressibility | ||||||||
pharynx | 7 | 22 | nounn | |||||
noun • the passage to the stomach and lungs; in the front part of the neck below the chin and above the collarbone | ||||||||
zanyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
exarchy | 7 | 22 | nounn | |||||
Valid word for Scrabble US
| ||||||||
lazyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hazelly | 7 | 22 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
whacky | 6 | 21 | adjectiveadj | |||||
adjective satellite • ludicrous, foolish • informal or slang terms for mentally irregular | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (275)
healthyholidaytherapyunhappyhighwaynaughtycharityhappilyanthonyheavilyhalfwayharmonywealthyhallwayhungarycharleycynthiaashtrayanarchyhillarysharplyearthlyempathyghastlyalchemyhearsayhaywireharshlyarcherycheaplyhartleyhumanlyhayridepathwaydeathly
...View all with 7 letters...
Phrases (17)
w. c. handyby heartheat rayhay balearmy hutholy dayholy manhardly ahair dyedry wash
...View all with 7 letters...
Words (428)
anythingbirthdayanywherephysicalthursdayhumanityalmightydaylightsympathyheavenlypharmacypaycheckmccarthymonarchyhysteriachastitymythicalhandymanhaystackhonoraryepiphanychechnyamahoganyladyshipshipyardyokohamastracheyladyfishchivalryheartilyhideawayfatherlyhathawayscratchystealthy
...View all with 8 letters...
Phrases (52)
shut awaysea nymphbaby shoecat thymethank youin the wayr. h. tawneybayt lahmdowny ashdowny haw
...View all with 8 letters...
Words (664)
authorityphysicianmachineryhyderabadgeographyhairstyleblasphemybiographyunhealthyhimalayashierarchylabyrinthtreacheryhemingwayhydraulicpolygraphpathologypantyhosedaylightstelepathyplayhousearchetypeunhappilyhydrazineplaythingemphysemascholarlyhonorablychlamydiaethicallyhimalayanayatollahfoolhardyhairsprayoligarchy
...View all with 9 letters...
Phrases (79)
by machineholy placelaugh awayready cashright awayhair dryeralex haleyhue and cryhell to payheavy spar
...View all with 9 letters...
Words (871)
physicallyhystericalpsychopathmelancholyhereditaryhyperspacesympathizedehydratedthankfullypsychiatryfaithfullyunbirthdayhydraulicsschoolyardsleepyheadarcheologychardonnaychemicallyhandsomelystealthilyplaywrightpythagorasdebaucherychurchyardarrhythmiatopographyscathinglysympathisetypographyinhumanitylachrymosecharminglyheroicallyarchetypalpaddywhack
...View all with 10 letters...
Phrases (145)
honey eatermoshe dayangenus khayawheat berrychalcid flyheavy swelljohnny cakespanish flyhanging flythird party
...View all with 10 letters...
Words (904)
technicallyphotographypsychiatrichospitalitysympatheticheavyweightcalligraphyarchaeologyhypothermiadehydrationhypermarkettchaikovskyshamelesslyhyperactivemetaphysicsfashionablyiconographyhorseplayerbaryshnikovbathyspherechronicallyhypospadiassynesthesiatachycardiatracheotomyasphyxiatedsympathizerhairstylistchancellerysphericallyschenectadyphysicalitypythagoreanunabashedlydehydrating
...View all with 11 letters...
Phrases (183)
humphry davyhigh qualitymary shelleyhoney badgerhuayna capacsensory hairhockey coachlaugh loudlylaugh softlyshy away from
...View all with 11 letters...
Words (909)
psychiatristchristianitychemotherapyhypocriticalchoreographystraightawayhypotheticalhistoricallyauthenticitymetaphysicalanthropologymythologicalpsychopathicformaldehydehystericallyhorizontallyasphyxiationtechnicalitynymphomaniacpatheticallyanaphylactichydrothermalrhythmicallymechanicallyhypothalamusperipherallyaromatherapytriumphantlyastrophysicsemphaticallyphilanthropypharmacologyharmoniouslypsychobabblemethodically
...View all with 12 letters...
Phrases (219)
chlorophyll amary mccarthyshaking palsyhockey leagueathletic typephantasy lifejohn roy majorbarbary sheepchristmas daywatch crystal
...View all with 12 letters...
Words (726)
psychologicaltheoreticallyhomosexualityautobiographypsychoanalystphysiologicalpsychosomaticchrysanthemumpsychotherapyhypochondriacphysiotherapyastonishinglyhyperactivityunsympatheticaestheticallypsychoanalyzehypoglycaemicdehydrogenasehybridizationsympathectomyphytoplanktonhallucinatoryantipsychotichydraulicallytheatricalityarchaeopteryxhydrocephalushypercalcemiacryptographerhumiliatinglystaphylococcithermodynamicsyntheticallytreacherouslyanthropophagy
...View all with 13 letters...
Phrases (229)
harvey cushingel iskandriyahhydrated oxidecardiac rhythmclyde tombaughorder of the dayjekyll and hydehigh-and-mightycedar mahoganydata hierarchy
...View all with 13 letters...
Words (634)
hypotheticallycinematographypsychoanalysismetaphoricallywholeheartedlymathematicallygeographicallyalphabeticallynanotechnologycardiomyopathyastrophysicistpathologicallythermodynamicselectrotherapyhyperventilateparapsychologypsychoanalyticcharacterologymetaphysicallytelepathicallyscholasticallynarcosynthesisphotogrammetrypsychodynamicsstaphylococcusencephalopathyinheritabilityphosphorylatedhydropneumaticorthopedicallyasynchronouslyplethysmographarchetypicallyunthinkabilitybiographically
...View all with 14 letters...
Phrases (263)
thoracic cavityanthony burgesslachrymal glandanthony van dyckanthony vandykemyrrhis odorataclass scyphozoablackberry bushbusman's holidayx-ray photograph
...View all with 14 letters...
Words (480)
psychologicallypsychotherapisttechnologicallysynchronizationanaesthesiologyphysiologicallyphilosophicallyphysiotherapistheterosexualitychronologicallysympathomimeticlymphadenopathyparentheticallytherapeuticallysynchronisationmethylphenidateencephalographylogarithmicallyauthoritativelycrystallographyhypochondriacalgynandromorphicpsychopathologysympatheticallyarchitecturallydemographicallyheartbreakinglypalaeopathologyeuphemisticallyneuropsychiatrypsychiatricallydiphenhydramineultrasonographyimperishabilitykinesthetically
...View all with 15 letters...
Phrases (342)
charlotte cordaydialysis machinemrs. humphrey wardwystan hugh audenjohn quincy adamshyoscyamus nigerspiny-headed wormfamily lophiidaex-ray photographyscholarly person
...View all with 15 letters...
Words (229)
enthusiasticallypheochromocytomacatastrophicallytriphenylmethanehyperventilationpsychoanalyticalphylogeneticallyelectromyographypharmaceuticallysphygmomanometererythroblastosisthermostaticallypsychobiologicalthrombocytopeniarhabdomyosarcomaphotographicallyparapsychologistneuropsychiatrichypersalivationsinextinguishablypornographicallyheterokontophytahymenophyllaceaeparaformaldehydethermometricallyantistrophicallyspondylarthritisradiographicallymicrogametophytehypersexualitiespolyphyleticallyinexhaustibilitypolyrhythmicallythermoplasticityhyperstimulating
...View all with 16 letters...
Phrases (340)
italian greyhoundchristian huygenscapital of hungarywilliam wycherleygenus crotaphytuschemical analysishypophyseal stalkalan lloyd hodgkinacross the countryhome away from home
...View all with 16 letters...
Words (148)
straightforwardlyanthropologicallyparathyroidectomythermodynamicallyphilanthropicallypsychotherapeutichyperreactivitiesphysiotherapeuticcercidiphyllaceaepolymorphonuclearunexchangeabilityparaformaldehydeshyperstimulationsparapsychologistshyperventilationsmonochromaticallysphygmomanometershypnotizabilitiesthrombocytopeniashypochondriacallychlortetracyclinemammothermographypathophysiologieshyposensitizationarchitectonicallymorphogeneticallylexicographicallylaryngopharyngealencephalomyelitiscrystallographerscrystallographieslymphadenopathieshyperalimentationlymphangiographiccyclophosphamides
...View all with 17 letters...
Phrases (364)
division bryophytasalvia leucophyllaczech monetary unitmary mcleod bethunehypoglycemic agentinterstate highwayclass rhodophyceaesubphylum craniatagenus symphalangustheological system
...View all with 17 letters...
Words (93)
characteristicallyhypercoagulabilitypsychopharmacologypsychopathologicalhyperaldosteronisminterchangeabilitysociopsychologicalneuropsychologicalhypersensitizationpolymorphonuclearsspectroheliographypsychotherapeuticssphygmomanometrieshypoparathyroidismpathophysiologicalhyposensitizationsanthropocentricitylaryngopharyngitislipopolysaccharidepostpsychoanalyticlymphangiographieshyperbilirubinemiaimmunocytochemicalstoichiometricallyautobiographicallypteridospermaphytadiethylmalonylureadistinguishabilitymucopolysaccharidehypercholesteremiasaccharomycetaceaephenomenologicallyhydroflumethiazideophthalmologicallypheochromocytomata
...View all with 18 letters...
Phrases (349)
division anthophytafamily physeteridaedame sybil thorndikelachrymal secretionfreudian psychologyafghan monetary unitjohn orley allen tateclass schizomycetesread-only memory chipfamily trichechidae
...View all with 18 letters...
Words (64)
hyperparathyroidismhydrochlorothiazidepsychophysiologicalcinematographicallyhypersensitizationsotorhinolaryngologyparathyroidectomieshypolipoproteinemiaparthenogeneticallyhypoparathyroidismsmucopolysaccharideslipopolysaccharidescytopathogenicitiesbacteriochlorophyllmagnetohydrodynamicpharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallyechoencephalographydehydrochlorinatingdehydrochlorinationphosphatidylcholinephosphoenolpyruvatechromoblastomycosiselectromechanicallythird-dimensionalityhysterosalpingogramthree-dimensionalityelectrophoreticallymethylcholanthrenesanthropocentricallyanthropomorphicallyelectroretinographycharacterologically
...View all with 19 letters...
Phrases (310)
hydrastis canadensisclass polyplacophoragiles lytton stracheyphytolacca americanadivision schizophytagenus cryptobranchusgenus symphoricarposavogadro's hypothesiscalycanthus floridusathyrium filix-femina
...View all with 19 letters...
Words (42)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallytetrahydrocannabinolparathyroidectomizedcrystallographicallyhyperadrenocorticismindistinguishabilitylymphogranulomatosesimmunocytochemicallylymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallymagnetohydrodynamicshistoincompatibilityelectrophysiologicalroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationpseudoparenchymatoushydrochlorothiazidespsychopathologicallypsychopharmacologiesmicrophotometrically
...View all with 20 letters...
Phrases (282)
honduran monetary unityellow-shafted flickerwyethia amplexicaulisfamily phytolaccaceaebalaenoptera physalusfamily trachipteridaemarchantia polymorphadivision tracheophytahundred-and-forty-fifthbalance sheet analysis
...View all with 20 letters...
Words (18)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologistmucopolysaccharidosisacetylcholinesterasesphosphoglyceraldehydeotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyclinicopathologicallytetrahydrocannabinolsPhrases (207)
igor ivanovich sikorskyaleksandr solzhenitsynhelichrysum bracteatumhungarian monetary unitbyzantine architectureparty to the transactionstrawberry haemangiomafamily rhinotermitidaearctostaphylos uva-ursiptolemy ii philadelphus
...View all with 21 letters...
Words (11)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyphosphoglyceraldehydesotorhinolaryngologicalotorhinolaryngologistscarboxymethylcelluloseelectrophysiologicallyhexamethylenetetramineencephalomyocarditisesdihydroxyphenylalaninePhrases (164)
haliaeetus leucorhyphusredevelopment authorityhydrated aluminium oxidetrazodone hydrochloridealeksandr i. solzhenitsynaccessory before the factmultiple mononeuropathysodium tripolyphosphaterhythm and blues musicianathyrium thelypteroides
...View all with 22 letters...
Words (5)
hydrochlorofluorocarboncarboxymethylcellulosespolytetrafluoroethylenehexamethylenetetramineshypobetalipoproteinemiaPhrases (127)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitdorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridangroup pteridospermaphyta
...View all with 23 letters...
Words (6)
laryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyphosphatidylethanolaminemicroelectrophoreticallyschizosaccharomycetaceaePhrases (96)
argyroxiphium sandwicensedivision heterokontophytasubphylum cephalochordataprivately held corporationprimary sex characteristicantiarrhythmic medicationexistentialist philosophytechnology administrationhypersensitivity reactionhenry wadsworth longfellow
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesuvulopalatopharyngoplastyPhrases (74)
embryonal rhabdomyosarcomaigor fyodorovich stravinskymary wollstonecraft shelleysymphoricarpos orbiculatuspolystichum acrostichoidesmelanerpes erythrocephalusbeggar-my-neighbour strategycaulophyllum thalictroidespyotr alexeyevich kropotkinsir arthur stanley eddington
...View all with 25 letters...
Phrases (57)
hunting and gathering societydorothy mary crowfoot hodgkinhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandrevolutionary calendar monthsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measures
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (40)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkinaugustus welby northmore pugindeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtenstein
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (30)
aleksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskydepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoy
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (17)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisontheory of punctuated equilibriumarrhenius theory of dissociationfyodor mikhailovich dostoyevskysecondary sexual characteristic
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (17)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library scienceethylenediaminetetraacetic acidwaterhouse-friderichsen syndromehyperbilirubinemia of the newbornmucocutaneous lymph node syndromehenri rene albert guy de maupassanttechnical analysis of stock trends
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (10)
digital communications technologyprimary subtractive color for lightrichard august carl emil erlenmeyermarie anne charlotte corday d'armontfibrocystic disease of the pancreasovulation method of family planningvladimir vladimirovich mayakovskinorth atlantic treaty organizationfrequency-response characteristicmary godwin wollstonecraft shelleyPhrases (16)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociationoculopharyngeal muscular dystrophyyevgeni aleksandrovich yevtushenko
...View all with 32 letters...
Phrases (10)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human serviceshighly active antiretroviral therapypositron emission tomography scannersubacute inclusion body encephalitisidiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (7)
first epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyauniversity of north carolina at chapel hillattention deficit hyperactivity disordersecretary of housing and urban developmentkarl friedrich hieronymus von munchhausendefense advanced research projects agencyPhrases (1)
respiratory distress syndrome of the newborn