Words Containing: W,K,I,E
(In Any Order)
There are 611 words,
600 phrases and
0 abbr's with
W,K,I,E in.
Best Scoring Words With: W,K,I,E
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
waxlike | 7 | 21 | adverb, adjectiveadv, adj | |||||
adjective satellite • having the paleness of wax | ||||||||
jawlike | 7 | 21 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
whiskey | 7 | 20 | nounn | |||||
noun • a liquor made from fermented mash of grain | ||||||||
whicker | 7 | 19 | verb, nounv, n | |||||
noun • the characteristic sounds made by a horse verb • make a characteristic sound, of a horse | ||||||||
bikeway | 7 | 19 | nounn | |||||
noun • A bicycle lane or path. | ||||||||
chewink | 7 | 19 | nounn | |||||
noun • common towhee of eastern North America | ||||||||
whisked | 7 | 18 | verbv | |||||
noun • a mixer incorporating a coil of wires; used for whipping eggs or cream • a small short-handled broom used to brush clothes verb • move somewhere quickly • move quickly and nimbly • brush or wipe off lightly • whip with or as if with a wire whisk | ||||||||
wickape | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
whisker | 7 | 17 | nounn | |||||
noun • a very small distance or space • a long stiff hair growing from the snout or brow of most mammals as e.g. a cat verb • furnish with whiskers | ||||||||
midweek | 7 | 17 | noun, adjectiven, adj | |||||
noun • the middle of a week • the fourth day of the week; the third working day adverb • in the middle of the week | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (109)
likewisesidewalkwrinkledwhiskerswreckingweaklingfireworkwickedlyzwiebackkatowicebiweeklyswankierclawlikemilkweedwineskinwormlikewakeningknitwearwigmakerwhiskerywolfliketwiglikewavelikewhiplikewackiestswanlikefawnliketweakingbowllikewreakingtwinklerwirelikelifeworkbrewskisinkwells
...View all with 8 letters...
Phrases (12)
whole kitwine caskmilk wheykaw riverlie awakewage hikekiwi vinewhite oakpink winework time
...View all with 8 letters...
Words (121)
fireworksawakeningshipwreckweakeningmilwaukeeclockwisefieldworkstinkweedweeknightswankiestwinemakerwhiskeredwisecrackwackinesswaterskinpieceworkwindbreakchickweedunwrinkleskywritergawkinesswomanlikereworkingswordlikeweaklingsscrewlikereawakingwaterskiskittiwakeinterworksidewalkswakeningswhaleliketweakiestwideawake
...View all with 9 letters...
Phrases (16)
kurt weillwine makerwinkle outwhite bookwhite cakewhole milkfield worksewing kitweak pointbreak wind
...View all with 9 letters...
Words (89)
wickednessperiwinklekieslowskiunwrinkledwunderkindbridgeworklawyerlikewinemakingweedkillerwraithlikewickerworkmakeweightbiweeklieschickweedswillowlikeswankinesspreworkingtimberworkworkingmenrewakeninghoodwinkedhoodwinkerunwrinklescandlewickironworkernetworkingwisecrackswinemakersflowerlikeweakfishesweaklinessknowingeststickweedspowderlikeinterworks
...View all with 10 letters...
Phrases (38)
line of workthink twicepawn ticketpigeon hawkfolk writerweed killerbook reviewkidney wortlake malawistrike down
...View all with 10 letters...
Words (102)
nightwalkeryellowknifewindbreakeroverworkingworkmanlikemawkishnesslawbreakingreawakeningkitchenwarelatticeworkawestrickenbewhiskeredinterworkedshipwreckedcandlewickstimberworkshoodwinkerstrellisworktimeworkersgawkishnessironworkerswisecrackedwisecrackerrainbowlikeforeknowingperiwinkleswaterskiingantiwrinklewackinessescakewalkingwickerworkswinterkillscheckrowinggawkinessescabinetwork
...View all with 11 letters...
Phrases (41)
strike a blowwinter breakwhite knightworking rulebowline knotwhiskey neatwhiskey souralice walkerpiece of workbox white oak
...View all with 11 letters...
Words (61)
sleepwalkingmetalworkingwicketkeeperwatermarkinglawbreakingswindbreakerscorkscrewingmisknowledgetrellisworkskitchenwareswisecrackerswisecrackinglatticeworksnewsweekliesswitchbackedcabinetworksspacewalkingweaklinesseswaterskiingswakeboardingswankinessesinterworkingwickednessesshipwreckingworkingwomenpickerelweedsemiweekliesunderworkingpieceworkersracewalkingsnightwalkerswunderkinderlower-rankingkatsuwonidaepinniewinkle
...View all with 12 letters...
Phrases (51)
desire to knownew brunswickwake-up signalwilliam blakepatrick whiteliterary worklake dwellingswagger stickrip van winklekurt waldheim
...View all with 12 letters...
Words (36)
acknowledgingstreetwalkinganticlockwisemetalworkingsknowingnessespickerelweedswakeboardingsinterworkingsworkabilitiessubnetworkingjabberwockiestiddledywinksmawkishnesseshawkishnessesmisknowledgesgawkishnessespinniewinklesweakishnessesnerve-wrackingwhiskerandoedconstablewickunworkmanlikewinterkillingwicketkeepersjawbreakinglyunknowingnesscheckweigherskirschwasserswonderworkingsleepwalkingswarlikenessessteelworkingshousewifeskepwhite-streakedkiddiewinkies
...View all with 13 letters...
Phrases (60)
white backlashmoscow kremlinlike clockworkdrinking waterblack-and-whitewilkie collinshigh-water markskilled workertrained workernetwork bridge
...View all with 13 letters...
Words (8)
streetwalkingscounterworkingconstablewickswinterkillingsweathercockingworkmistresseshousewifeskepsdisacknowledgePhrases (47)
stephen hawkingblended whiskeykwajalein atollstinking wattleswimming strokeskilled workmanweekend warriorwilliam crookeswishful thinkerkiliwa language
...View all with 14 letters...
Words (9)
unworkabilitiesunknowabilitiesthankworthinessquick-wittednesscontraclockwiseknowledgabilityunknowingnessesdisacknowledgeddisacknowledgesPhrases (59)
battle of okinawamanner of walkingrainbow lorikeethookworm diseasekingdom of swedenwalking delegatehawksbill turtlekepler's first lawwilliam mckinleyknowledge domain
...View all with 15 letters...
Phrases (12)
jerusalem artichoke sunflowersir frederick william herschelwrangell-st. elias national parkhawai'i volcanoes national parkhawaii volcanoes national parkindustrial workers of the worldwilliam iv of the united kingdombaron karl wilhelm von humboldtkepler's law of planetary motionmaurice hugh frederick wilkins
...View all with 27 letters...
Phrases (1)
financial crimes enforcement networkPhrases (1)
cosmic microwave background radiationPhrases (1)
international relations and security network