Words Containing: T,I,N,N,E,R
(In Any Order)
There are 5,468 words,
5,118 phrases and
0 abbr's with
T,I,N,N,E,R in.
Best Scoring Words With: T,I,N,N,E,R
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| thinner | 7 | 10 | adjectiveadj | |||||
noun • a diluting agent | ||||||||
| vintner | 7 | 10 | nounn | |||||
noun • someone who sells wine • someone who makes wine | ||||||||
| renting | 7 | 8 | verb, noun, adjectivev, n, adj | |||||
noun • the act of paying for the use of something (as an apartment or house or car) | ||||||||
| ringent | 7 | 8 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| entrain | 7 | 7 | verbv | |||||
verb • board a train | ||||||||
| ternion | 7 | 7 | nounn | |||||
noun • the cardinal number that is the sum of one and one and one | ||||||||
| intoner | 7 | 7 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| interns | 7 | 7 | nounn | |||||
noun • an advanced student or graduate in medicine gaining supervised practical experience verb • work as an intern • deprive of freedom | ||||||||
| interne | 7 | 7 | verb, noun, adjectivev, n, adj | |||||
noun • an advanced student or graduate in medicine gaining supervised practical experience | ||||||||
| tinners | 7 | 7 | verb, nounv, n | |||||
noun • someone who makes or repairs tinware | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (58)
internetenteringinternalinventornitrogeninherentreinventnutrientneutrinointranetrenitentretuningintrenchinthroneinturnedvintnerscentringthinnersinterneeternionsinventertenuringindenterindentorretineneinvertinanointerincenterentrainsreanointtrainmenrunniesttrienniaintenderferninst
...View all with 8 letters...
Phrases (2)
tv dinnerin returnWords (202)
returningargentinaentertaincontainerinventoryuncertainprominentinterveneprincetonbernsteinparentingtangerinecenturionincarnateserotonininsertionpertinentunwritteninnermostbannisteruntrainedrenditionpinkertonretentiontransientstringentinsurgentinertnessventuringinternistreunitingincrementitinerantcenteringindenture
...View all with 9 letters...
Phrases (18)
in earnesttennis protin openerin concertwinter urnginger nutnear thingdinner settree onionnicker nut
...View all with 9 letters...
Words (428)
generationpretendinginstrumentquarantinerenovationingredientinternshipdinnertimegeneratinginternallypreventionintervenedintolerantinherentlyrenovatingthunderingencryptionrefinementinternmentincoherentserpentineinheritingstrychninevenerationturpentineshorteningincinerateflorentinerethinkingenrichmentintertwinegrindstoneinordinatepretensionreprinting
...View all with 10 letters...
Phrases (28)
next friendenergy unitthin personcenter linestring linedean martininner lightlinden treetrade unionmu neutrino
...View all with 10 letters...
Words (675)
interestingenvironmentthreateningfrighteningrecognitioninheritanceresignationinterferingconditionerfingerprintorientationindifferententertaineduncertaintyinteractionterminationpremonitionintegrationentertainerpenetratingundertakingnourishmentchristeningincinerateddetermininghibernationarraignmentimpertinentalternatingincriminatequarantinedargentinianintolerancereminiscentintertwined
...View all with 11 letters...
Phrases (67)
breathing inin agreementtransit linesingle entryrunning materunning timetearing downdinner partydinner platein operation
...View all with 11 letters...
Words (845)
conversationpresentationinstrumentalkindergartenentertaininginterferenceinterventionimprisonmentcongregationintersectiontransferringinterruptionfrankensteinveterinarianpenitentiaryconservationregenerationinsurrectionintermissioninterpretingintermittentinterceptionindiscretioninfringementfraternizinghypertensionenterprisingdegenerationinterminablecounterpointremunerationfermentationincoherentlyguaranteeingmenstruating
...View all with 12 letters...
Phrases (118)
jan tinbergenmount rainierkitchen rangenorthern pikeinput routineinquiry agentanimal natureivan turgenevdinner bucketrental income
...View all with 12 letters...
Words (847)
internationalunderstandingentertainmentdemonstrationconcentrationinterrogationconsiderationenvironmentalmisunderstanddeterminationreincarnationmediterraneanconcentratinginterrogatingexterminationdemonstratinginconsiderateinterestinglyreunificationreinforcementstrengtheningimpersonatingquestionnairecontraceptioninadvertentlyincarcerationuninterestingpredominantlyoverconfidentuninterruptedtransgressionconfederationimpersonationdisconcertingfrighteningly
...View all with 13 letters...
Phrases (189)
direct antonymmeasuring unitgrain merchantinventory itembrandy snifternursing bottleturbinate bonespiny anteaterinverse secantcarved in stone
...View all with 13 letters...
Words (807)
recommendationsuperintendentinterpretationrepresentationreconstructionreconciliationdisorientationinterconnectedantidepressantdisintegrationindiscriminateinterplanetarydisintegratingaforementionedinsurmountablemountaineeringdeconstructionreorganizationinternationaleconversationalfingerprintingnitroglycerineintermittentlyfraternizationreconnoiteringreimplantationreintroductiongeneralizationpredestinationinterdependentreconstitutionarrondissementneutralisationnarcosynthesisrelinquishment
...View all with 14 letters...
Phrases (297)
protein foldingclementine treecount per minutesir john tennielsurface tensionterra incognitadebt instrumentpresident nixonwalter lippmannresistance unit
...View all with 14 letters...
Words (698)
internationallyexperimentationenvironmentallypersonificationentrepreneurialinterchangeabledifferentiationunsportsmanlikeparthenogenesiscontraindicateduncontroversialdifferentiatinginstrumentationplenipotentiarypretentiousnessamericanizationrevolutionizingneoconservativeinterventionistconservationistinterconnectiontrinitrotolueneinstrumentalityenfranchisementinvulnerabilityuncomplimentaryomnidirectionalnonexperimentalcounterirritantunparliamentaryunrighteousnessnoninterventionuninterruptedlyinternalisationanticholinergic
...View all with 15 letters...
Phrases (377)
italian dressingjunction barriernewton's first lawnewton's third lawprivate nuisancecuban revolutiongenus priodontespalestinian arabhundred-and-firsteccentric person
...View all with 15 letters...
Words (309)
misunderstandingintercontinentalenvironmentalistindiscriminatelyneurotransmittergastrointestinaltranscontinentalincontrovertibleenvironmentalismcounteroffensivecountersignaturetriphenylmethanetransubstantiaterepresentationalhyperintelligentcounterespionagecounterintuitivehyperventilationentrepreneurshipundernourishmentreinterpretationnonrevolutionarydemineralizationdenaturalizationintraventricularovercompensationinterpretationalinterventricularincontrovertiblyteleconferencingpredeterminationunattractivenessundifferentiateddecentralizationunderachievement
...View all with 16 letters...
Phrases (391)
tympanic membranein a beastly manneritalian greyhoundgenus angiopterispresident johnsonchelonian reptilechristian huygenssonic depth finderdefinite integralin an elaborate way
...View all with 16 letters...
Words (239)
depersonalizationconversationalistcounterinsurgencymisinterpretationintergovernmentalimmunosuppressanttranscendentalismmisrepresentationcounterrevolutiondeconstructionistreconstructionismreconstructionisttranscendentalistinappropriatenessdisinterestednessinterrelationshipinterdisciplinaryinterdepartmentalantirevolutionarycounterscientificcountersignaturessuperintelligenceantischizophreniaantischizophrenicthermoluminescentuniversalizationsdeconstructionisminformativenessesunobtrusivenessescountersuggestionkindheartednessescountertendenciesdisfranchisementsinheritablenessesnonproductiveness
...View all with 17 letters...
Phrases (475)
horizontal sectionobject recognitionmary leontyne pricecompetence hearingczech monetary unitnikolaas tinbergencuban monetary unitsemiconductor unitfootprint evidencecenter of attention
...View all with 17 letters...
Words (136)
compartmentalizinginternationalizinginterconnectednessdisenfranchisementoverrepresentationinterchangeabilitythermoluminescencehypersensitivenesshypersensitizationmisinterpretationscountersuggestionsmisrepresentationsfaintheartednessesrambunctiousnessesunprofitablenessesdisintermediationscompartmentalisingunrestrainednessespostmillenarianismanthropocentricitynonrepresentativesnonrevolutionariestranscendentalismstranscendentalistsreconstructionismsvaletudinarianismsreconstructionistscongregationalismspertinaciousnessescounterintuitivelycongregationalistsmagnetoresistancespredestinarianismsdeconstructionistsdecriminalizations
...View all with 18 letters...
Phrases (447)
hindu calendar monthbusiness enterpriseamerican revolutiondrafting instrumentpresident jeffersonanamnestic reactionadministrative unitafghan monetary unitnathaniel hawthorneinterior decorating
...View all with 18 letters...
Words (108)
counterintelligenceelectroluminescencethermoluminescencesdisenfranchisementshypersensitizationscountersurveillanceextraordinarinessesprofessionalisationunpretentiousnessesprofessionalizationultracentrifugationnonproductivenessesdisinterestednessesparthenogeneticallypostmillenarianismsnonrelativisticallycomplementarinessesuntranslatabilitiesreconceptualizationresorcinolphthaleincytodifferentiationmagnetohydrodynamictransplantabilitiesgedankenexperimentsreindustrializationimmunoprecipitatingimmunoprecipitationreinstitutionalizedreinstitutionalizesintercommunicationsdehydrochlorinatingdehydrochlorinationmercury-contaminatedtridimensionalitiesdeindustrialization
...View all with 19 letters...
Phrases (454)
water-plantain familymeasuring instrumentrecursive definitionitalian monetary unitsuperior conjunctionhydrastis canadensislatvian monetary unitread between the lineszairese monetary unitvertical combination
...View all with 19 letters...
Words (57)
counterrevolutionarycompartmentalizationinternationalizationtetrahydrocannabinolhypersensitivenesseskeratoconjunctivitescountersurveillancesunrepresentativenesscounter-revolutionistunsatisfactorinessesreconceptualizationscounterdemonstrationcytodifferentiationsreindustrializationsinterchangeabilitiesimmunoprecipitationsphiloprogenitivenessreinstitutionalizingcounterrevolutionistneuroendocrinologistinterconnectednessesdehydrochlorinationsdeindustrializationsadrenocorticotropinselectroluminescencesrepresentationalismsrepresentationalistsbuckminsterfullerenerepresentativenessesultracentrifugationsadrenocorticotrophinmagnetohydrodynamicsphotodisintegrationsprofessionalizationsinappreciativenesses
...View all with 20 letters...
Phrases (389)
sweet-scented geraniumhonduran monetary unitappendicular skeletonprofessional relationmalawian monetary unitinstruction executionlebanese monetary unitbusiness organisationmultilinear evolutionbusiness organization
...View all with 20 letters...
Words (17)
disestablishmentariancompartmentalizationsestablishmentarianisminterchangeablenessesneuroendocrinologistsinterconvertibilitiesadrenocorticotrophinsotorhinolaryngologiesbuckminsterfullerenesinternationalizationsincomprehensibilitiescounterdemonstrationsoverintellectualizingantiferromagneticallyundemonstrativenessescounterinterpretationtetrahydrocannabinolsPhrases (353)
administrative hearingelimination tournamentsierra nevada mountainsexperimental conditionicelandic monetary unitelectrolytic condenseraleksandr solzhenitsynmalaysian monetary unitexecution of instrumentbulgarian monetary unit
...View all with 21 letters...
Words (12)
counterrevolutionarieskeratoconjunctivitideskeratoconjunctivitisesdisestablishmentariansunrepresentativenessesnonrepresentationalismreinstitutionalizationphiloprogenitivenessesintercomprehensibilityhexamethylenetetramineestablishmentarianismscounterinterpretationsPhrases (289)
venezuelan monetary unitlycopersicon esculentumadministrative divisiongregorian calendar monthprunus persica nectarinatransient global amnesianavigational instrumentaleksandr i. solzhenitsyninstrument of punishmentjohn ronald reuel tolkien
...View all with 22 letters...
Words (4)
nonrepresentationalismsreinstitutionalizationshexamethylenetetraminesoverintellectualizationPhrases (217)
gilbert and ellice islandsparenthetical expressiontransient ischemic attackchlorpheniramine maleateto all intents and purposesyellowstone national parkkazakhstani monetary unitparis-sorbonne universityinterlocutory injunctionlewis and clark expedition
...View all with 23 letters...
Words (3)
laryngotracheobronchitisintercomprehensibilitiesoverintellectualizationsPhrases (178)
carnegie mellon universityprofessional organisationprofessional organizationlowland burrowing treefrogdivision heterokontophytamary wollstonecraft godwinsir terence mervyn rattigandistinguished flying crossfrancois auguste rene rodinadolf otto reinhold windaus
...View all with 24 letters...
Words (1)
antiestablishmentarianismPhrases (154)
count ferdinand von zeppelincluster of differentiation 4cruel and unusual punishmentcentral intelligence agencyfast local internet protocolboris leonidovich pasternakwar of the spanish successionsecret intelligence serviceantonio allegri da correggioamerican baptist convention
...View all with 25 letters...
Phrases (97)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettx-linked dominant inheritancepolicing and enforcement costalternanthera philoxeroidescorrectional rehabilitationhunting and gathering societylassen volcanic national park
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (83)
business environment analysispartial differential equationamerican revolutionary leaderelectromechanical transducersolenostemon scutellarioidesnational labor relations boardaugustus welby northmore puginbeta-adrenergic blocking agentelectronic musical instrumentnuclear regulatory commission
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (87)
interstate commerce commissionbureau of engraving and printingtriphosphopyridine nucleotidemarcus junius brutus the youngerdistinguishing characteristiccardiopulmonary resuscitationbattles of lexington and concordthird council of constantinoplecapital of serbia and montenegrojohan julius christian sibelius
...View all with 28 letters...
Phrases (67)
business environmental analysisbusiness interruption insurancechemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organnational volunteers associationdisorganized type schizophreniacombination in restraint of tradecapital of the dominican republic
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (53)
valentina vladmirovna tereshkovareduced instruction set computingalexander isayevich solzhenitsynglutamic oxalacetic transaminaseself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencecoluber constrictor flaviventrisjacques anatole francois thibaultdepository financial institution
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (56)
great smoky mountains national parkbureau of intelligence and researchfreedom from involuntary servitudepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movementsidonie-gabrielle claudine coletteunited states trade representativefrances elizabeth caroline willard
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (26)
people against gangsterism and drugspatent and trademark office databaseweakly interacting massive particleintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationobject-oriented programing languagecount nikolaus ludwig von zinzendorfnonsteroidal anti-inflammatory druguniversity of california at berkeley
...View all with 32 letters...
Phrases (31)
linear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languagecongress of industrial organizationslycopersicon esculentum cerasiformeobject-oriented programming languageorganization of the oppressed on earth
...View all with 33 letters...
Phrases (29)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal national mortgage associationacademy of television arts and sciencescosmic microwave background radiationinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitz
...View all with 34 letters...
Phrases (27)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycomte donatien alphonse francois de sade
...View all with 35 letters...
Phrases (20)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtjuan carlos victor maria de borbon y borbonfield-sequential color television systemfreedom from cruel and unusual punishmentalbert francis charles augustus emmanueltransportation security administration
...View all with 36 letters...
Phrases (15)
united states declaration of independencetheodore roosevelt memorial national parkuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiongenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciences
...View all with 37 letters...
Phrases (8)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemdemocratic republic of sao tome and principeinternational civil aviation organizationeconomic commission for asia and the far eastdepartment of housing and urban developmentadvanced research and development activityPhrases (11)
million floating point operations per secondbillion floating point operations per seconddefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestinebaron hermann ludwig ferdinand von helmholtz
...View all with 39 letters...
Phrases (10)
association of islamic groups and communitiesminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenregents of the university of california v. bakkeinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance grouptrillion floating point operations per secondPhrases (8)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (6)
international bank for reconstruction and developmentfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationsunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing
