Words Containing: S,Y,N,G,E
(In Any Order)
There are 1,229 words,
1,695 phrases and
0 abbr's with
S,Y,N,G,E in.
Best Scoring Words With: S,Y,N,G,E
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
oxygens | 7 | 18 | nounn | |||||
noun • a nonmetallic bivalent element that is normally a colorless odorless tasteless nonflammable diatomic gas; constitutes 21 percent of the atmosphere by volume; the most abundant element in the earth's crust | ||||||||
synergy | 7 | 14 | nounn | |||||
noun • the working together of two things (muscles or drugs for example) to produce an effect greater than the sum of their individual effects | ||||||||
cygnets | 7 | 13 | nounn | |||||
noun • a young swan | ||||||||
bygones | 7 | 13 | nounn | |||||
noun • past events to be put aside adjective satellite • well in the past; former | ||||||||
pigsney | 7 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
espying | 7 | 13 | verbv | |||||
verb • catch sight of | ||||||||
dingeys | 7 | 12 | nounn | |||||
Valid word for Scrabble US
| ||||||||
dyeings | 7 | 12 | nounn | |||||
noun • the use of dye to change the color of something permanently | ||||||||
syringe | 7 | 11 | verb, nounv, n | |||||
noun • a medical instrument used to inject or withdraw fluids verb • spray or irrigate (a body part) with a syringe | ||||||||
gayness | 7 | 11 | noun, adjectiven, adj | |||||
noun • a sexual attraction to (or sexual relations with) persons of the same sex | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
syngeWords (60)
youngestsyringesshenyangguernseymoseyinggraynesssnuggerygreyhenssyringedyeastingsynergiacryogensresayingessayingguylinesensigncyenskyinggeognosylangsynezymogensyealingssynergicsynergidgreynessserryingsyngasesdysgenicgypseianpigsneyssyngenicglycineseryngoeslangleyspyrogensnosegays
...View all with 8 letters...
Phrases (5)
sentry gogenus myaby designlang synegreen soyWords (121)
strangelyseeminglysynagogueyoungstermoneybagseasygoingsurveyinghygienistdysgenicssteadyinggreystoneteasinglyglueynessjestinglysynergismhygienicsoxygenasesypheringstymieingyeanlingsyearningsnongreasyrestylingsubagencysyngeneicegyptiansamylogenslayeringsglycogenspolygenessynergistgreenwaysstrongylesearinglyguernseys
...View all with 9 letters...
Phrases (15)
genus nypaeasy goinggenus hylagenus lynxtype genusgenus jynxgenus gypsgenus bryagenus cyonbandy legs
...View all with 9 letters...
Words (167)
generositytestifyinggenerouslyinsurgencyspecifyingstringencycryogenicspleasinglycurtseyingstupefyingsneeringlydesignedlylengthwayssynergeticpanegyristandrogynessonglesslygynarchiespressinglysynergismspanegyricsrestudyinggynophoresamnestyingsneakinglyhydrangeasresprayingroysteringsweepinglysanguinelyselenologyyoungstersdensifyinggymnospermdisobeying
...View all with 10 letters...
Phrases (32)
yves tanguygenus lygusgenus khayagenus cycasgenus physagenus caryapenny grassgenus typhain a pig's eyesnowy egret
...View all with 10 letters...
Words (180)
sovereigntydangerouslyscientologydeservinglytypesettingunceasinglykinesiologysickeninglysynergisticingenuouslystringentlysuperagencytypecastingscenographyscreaminglyingeniouslyyesternightpsychogenicstenographygrandioselygymnospermsprophesyingkeystrokingoverstayingnecropsyinginsurgentlycaressinglyflyspeckingexocytosingexogenouslysovereignlypanegyristscourtesyingsystemizingemulsifying
...View all with 11 letters...
Phrases (68)
genus lycosagenus myxinelaying wastegenus styraxbulb syringesingle entrygenus bombyxglossy snakegenus cygnusgenus zoysia
...View all with 11 letters...
Words (219)
increasinglygynecologiststorytellingneurosurgeryrefreshinglystaggeringlystereotypingintensifyingdepressinglydespairinglyresoundinglygroundlesslydiversifyinglaryngoscopereassuringlysynthesizingpersonifyingnauseatinglyhesitatinglymisleadinglybeseechinglyungenerosityungenerouslysyncretisingmoneymakingsgranulocytesblisteringlysyncretizinggerrymandersoropharyngesdemystifyingwhisperinglyoxygenationsdisembodyingretestifying
...View all with 12 letters...
Phrases (102)
staying powergenus glycinegenus syringastring theorygenus cydoniagenus apteryxgenus tayassugenus halcyongenus cyperusgalveston bay
...View all with 12 letters...
Words (156)
interestinglygynaecologisteverlastinglydehydrogenasedistressinglymeaninglesslyquestioninglyphysostigminehypothesisinggeostationaryproselytizinghypothesizingunderstudyingpsychogeneticresolidifyingpostemergencygymnospermiesundisguisedlyreclassifyingserpiginouslyperseveringlydeclassifyingunrighteouslyoversupplyingsystematisingsystematizingsaprogenicityembryogenesesembryogenesispsychosurgeondisquietinglyproteoglycanseasygoingnesspsychogenesispresignifying
...View all with 13 letters...
Phrases (141)
harvey cushingwaste of energygenus bradypusgenus cyclamengenus gypaetusgenus scolymusgenus acinonyxgenus cyprinusgenus martyniagenus nymphaea
...View all with 13 letters...
Words (121)
cytogeneticistembarrassinglygeosynchronousunsuspectinglyanesthesiologyunhesitatinglyadvantageouslydisingenuouslydehydrogenasesspellbindinglyglycogenolysisovergenerouslyexasperatinglyresynthesizingintransigentlymoneygrubbingsearthshakinglyestrogenicallydehydrogenatesmisidentifyingoxyhemoglobinssyringomyeliasphysostigminesdeoxygenationscryopreservingglycogenolysesphytopathogenshypomagnesemiaovergenerositypyrogenicitiespeptidoglycanspsychosurgeonslysogenicitieslysogenizationlaryngectomees
...View all with 14 letters...
Phrases (172)
anthony burgessgenus gossypiumgenus syngoniumdrainage systemgenus gymnogypsoyster dressingturkey stuffingoyster stuffinggenus nymphicusmargin of safety
...View all with 14 letters...
Words (94)
anaesthesiologysynergisticallyoversimplifyingcondescendinglyneurophysiologyrecrystallizingunquestioninglycorrespondinglysidesplittinglyheterogeneouslycommiseratinglydisenchantinglydishearteninglyoverclassifyingnitroglycerineshypervigilanceshyposensitizingresystematizingcytogeneticistsethnomusicologydisconcertinglyagranulocytosesunderstandinglyeasygoingnessespsychogenicallycongressionallysemipornographyhypomagnesemiasgyrofrequenciescrossopterygianstrongyloidoseslysogenizationsintransigeantlycounterstrategyneuropsychology
...View all with 15 letters...
Phrases (195)
asamiya languagewystan hugh audengenus sylvilagusgenus bombycillahyoscyamus nigergempylus serpensgenus cyanocittamask of pregnancydoris may lessinggenus eriobotrya
...View all with 15 letters...
Words (28)
sphygmomanometerinextinguishablyhypersensitizinghyperstimulatingsphygmomanometryglossopharyngealcrossopterygianslyginopteridalesstenographicallyflabbergastinglygastroenterologycytotechnologiescytotechnologiststrongyloidiaseslymphangiectasialymphangiectasisconsanguineouslyoligodendrocytessyncategorematicdehydrogenationsneurophysiologicotolaryngologiesgynandromorphiesinterstratifyingphototypesettingchymotrypsinogenevangelisticallygymnospermophytaPhrases (164)
strictly speakingchristian huygensgenus crotaphytusbluegrass countrygenus aptenodytesgenus cynoglossumnervus hypoglosusisland of guernseyorder polygonalespharyngeal tonsil
...View all with 16 letters...
Words (17)
counterinsurgencyneurophysiologistsphygmomanometersgastroenterostomycytotechnologistsstrongyloidosisessamoyedic-speakingglossopharyngealsneurophysiologiesdisadvantageouslyneuropsychologiesneuropsychologistdephosphorylatingphotosynthesizingphototypesettingsdemythologisationchymotrypsinogensPhrases (155)
interstate highwaypearly everlastinggenus symphalangusmalaysian languageyeniseian languagecrataegus monogynagenus haematoxylongenus haematoxylumgenus chlamyphorusgenus dactylorhiza
...View all with 17 letters...
Words (14)
neuropsychologicalsphygmomanometrieshypophysectomizinglymphangiographiesmagnetostrictivelygranulocytopoiesesgranulocytopoiesisneurophysiologistsneuropsychologistsdemythologizationssedimentologicallydihydroergotaminesneurophysiologicalhyperpigmentationsPhrases (135)
freudian psychologygenus styracosaurusnavigational systemantipsychotic agentmegacycle per secondgenus chamaecytisuscrataegus oxycanthawedding anniversarygenus archaeopteryxgenus phyllostachys
...View all with 18 letters...
Words (5)
extralinguisticallycytopathogenicitieshysterosalpingogramphytohemagglutininsmedroxyprogesteronePhrases (95)
building supply housejohn millington syngefamily cynoglossidaegiles lytton stracheygenus cryptobranchusgenus symphoricarpossalicylate poisoninguniversity of chicagocrataegus oxyacanthaunix operating system
...View all with 19 letters...
Words (6)
lymphogranulomatosesmagnetofluiddynamicsoophorosalpingectomyneurophysiologicallymagnetohydrodynamicssyncategorematicallyPhrases (76)
byelorussian languageclassifying adjectiveluscinia megarhynchosaustralian bonytonguegenus ornithorhynchusgenus campylorhynchusbasidiomycetous fungisaturday night specialbahasa melayu languagewilliam jennings bryan
...View all with 20 letters...
Words (1)
laryngotracheobronchitisPhrases (36)
carnegie mellon universityargyroxiphium sandwicensemary wollstonecraft godwinzollinger-ellison syndromesir terence mervyn rattigandistinguished flying crosstechnology administrationhenry wadsworth longfellowpaul johann ludwig von heyseposterior meningeal artery
...View all with 24 letters...
Phrases (24)
diamond wedding anniversaryfrancis scott key fitzgeraldedmund john millington syngereligious society of friendsbeggar-my-neighbour strategysir arthur stanley eddingtonreticular activating systemarab revolutionary brigadespodkamennaya tunguska rivercygnus columbianus bewickii
...View all with 25 letters...
Phrases (21)
brassica oleracea gongylodeshunting and gathering societyevelyn arthur saint john waughassyrian neo-aramaic languagenewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiamyrtillocactus geometrizansgilles de la tourette syndromecalifornia single-leaf pinyon
...View all with 26 letters...
Phrases (20)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore puginnuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoinformation processing system
...View all with 27 letters...
Phrases (15)
revolutionary people's struggleephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemrevolutionary communist leaguesingle nucleotide polymorphismimperial japanese morning gloryaspidophoroides monopterygiushypothalamic releasing hormonemilitary intelligence section 5
...View all with 28 letters...
Phrases (11)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnonsteroidal anti-inflammatory drugoculopharyngeal muscular dystrophylymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united statesbosnian-herzegovinian monetary unit
...View all with 32 letters...
Phrases (8)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systempositron emission tomography scannerunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay