Words Containing: S,N,I,D,E,L,Y
(In Any Order)
There are 432 words,
714 phrases and
0 abbr's with
S,N,I,D,E,L,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
fiendishly | 10 | 20 | adverb, adjectiveadv, adj | |||||
adverb • as a devil; in an evil manner | ||||||||
xylidines | 9 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
defensibly | 10 | 19 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
amplidynes | 10 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
kindlessly | 10 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
diphenyls | 9 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
splendidly | 10 | 17 | adverb, adjectiveadv, adj | |||||
adverb • wonderfully • in an impressively beautiful manner | ||||||||
windlessly | 10 | 17 | ||||||
Valid word for Scrabble US
| ||||||||
mindlessly | 10 | 16 | adverb, adjectiveadv, adj | |||||
adverb • without intellectual involvement • in an unreasonably senseless manner | ||||||||
designedly | 10 | 16 | adverbadv | |||||
adverb • with intention; in an intentional manner | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
snidelyWords (1)
dyelinesWords (27)
disneylandsplendidlymindlesslyfiendishlystridentlyunsteadilydesignedlydefensiblywindlesslyresignedlyamplidyneskindlesslyxyloidinescordylinessyndeticalseducinglyunbiasedlyhyaliniseddebasinglystrainedlydisfluencylow-densityleylandiisone-sidedlysylphidineagonisedlyklendusityPhrases (3)
field pansywalt disneyalkyd resinWords (43)
defensivelydishonestlydeservinglyundesirablysecondarilyunadvisedlygrandioselyunsoldierlypolyandriesvinylidenessustainedlydelusionaryladyfingerslysogenisedlysogenizeddailynessescyclodienesdiscerniblypendulositysedentarilyspreadinglyself-denyingunsightedlyspondylitesspiny-leafedspiny-leaveddesigninglydrainlayerssdeignfullycylindritesdispensablycorydalinesincreasedlyunbiassedlydiethylenes
...View all with 11 letters...
Phrases (5)
coney islandleyte islandflux densitysydney silkybody englishWords (63)
considerablydepressinglydespairinglyresoundinglyindiscreetlyindefensiblymendaciouslymisleadinglyindecisivelyrestrainedlyiridescentlydesolatinglyinterestedlydoxycyclinesdicotyledonsdiscrepantlyindigenouslydiscerninglydemulsifyingsyndactyliessyndeticallyindecorouslydecreasinglydisemployingredisplayingmolybdeniteshydralazinesindefeasiblydisjointedlyshudderinglyyieldingnessbenzylidinesuser-friendlylaryngitidessanctifiedly
...View all with 12 letters...
Phrases (10)
sundew familydisplay panelalfred kinseyday blindnessfield soybeanbicycle standenglish daisyneedle biopsylibyan desertsafety islandWords (76)
distressinglydimensionallydistinctivelyincredulouslyindescribablyconsideratelyclandestinelyencyclopedisthyaluronidaseresolidifyingencyclopediasundisguisedlycompendiouslydisobedientlylymphadenitisdeclassifyingdisquietinglycyclodextrinsequidistantlytendentiouslysedimentologyconstrainedlysemilegendarydisjunctivelyencyclopedismoleandomycinsdevastatinglysubordinatelytiddledywinksclandestinitynearsightedlyasyndeticallysynecdochicalindispensablyspondylitises
...View all with 13 letters...
Phrases (29)
el iskandriyahgenus dactylismyles standishprinted symbolvachel lindsaygenus lygodiumchelonia mydasline of destinycylinder pressblended whisky
...View all with 13 letters...
Words (82)
dimensionalityinconsiderablydisconsolatelydisingenuouslyabsentmindedlydiscontentedlyindestructiblypolybutadienesunrestrainedlydistensibilityspellbindinglyhedonisticallydisappointedlydiphenylaminesincandescentlyindemonstrablyencyclopaediasencyclopedismsencyclopedistsdemyelinationssimplemindedlypresidentiallyundesirabilityinsecticidallydispensabilityuncrystallizedadventitiouslyhyaluronidasesdisconnectedlypeptidoglycanshydroxylaminesdicotyledonousphencyclidinesmonoglyceridesendoscopically
...View all with 14 letters...
Phrases (23)
field intensitymoonseed familyblended whiskeyemily dickinsonlatter-day saintsonic delay linepresident tylerfully fashionedblessed trinitygenus chlamydia
...View all with 14 letters...
Words (52)
condescendinglydemonstrativelydispassionatelycorrespondinglyinconsideratelydemonstrabilitysidesplittinglyserendipitouslydisenchantinglydishearteninglydisinterestedlysemicylindricaldorsoventralitypolynucleotidesdisconcertinglyunderstandinglylymphadenitisessplendiferouslysynecdochicallyplatinocyanideselectrodynamicsstrongyloidoseshydroxyprolineshendecasyllabicindigestibilityindefeasibilityindefensibilitydorsiventralityinsubordinatelyyieldablenessesencyclopaedismsencyclopaedistscylindricalnessdemythologisinghyperadrenalism
...View all with 15 letters...
Phrases (44)
helen wills moodydialysis machinedoris may lessingdrive line systemalexandre yersinanglo-saxon deitywalt disney worldplayground slidepresident taylorfield pennycress
...View all with 15 letters...
Words (18)
indiscriminatelyadministrativelyindiscernibilityindispensabilitylyginopteridalesstrongyloidiasesdecarboxylationsoligodendrocytesindescribabilityadenohypophysialmethylphenidateshendecasyllabicsancylostomatidaeendopolyploidiesepichlorohydrinsnondestructivelypyelonephritidespolycondensationPhrases (38)
laundry stiffenerisland of guernseygrand mal epilepsyflat panel displayfamily serranidaesir edmund hillarybramley's seedlingpyroligneous acidholy innocents' daypolygenic disease
...View all with 16 letters...
Words (22)
interdisciplinaryself-contradictoryspondylolisthesisunderstandabilitylymphadenopathiesstrongyloidosisesdehydrochlorinasetridimensionalityindestructibilityjurisprudentiallydisadvantageouslydeoxyribonucleasedephosphorylatingdephosphorylationdepolymerizationstwo-dimensionalityone-dimensionalitydeterministicallyundemonstrativelydemythologisationunidimensionalitypolycondensationsPhrases (60)
cylinder separatorcaesarian deliverydisorderly conductsubfamily turdinaegenus dactylorhizadisability benefitdisability paymentacoustic delay linewindsor eyeglassesgenus hydrodamalis
...View all with 17 letters...
Words (12)
disproportionatelyhyperaldosteronismcylindrical-stemmeddehydrochlorinasesdehydrochlorinatesdemythologizationsmethylprednisolonedeoxyribonucleasesdephosphorylationssedimentologicallydimethylhydrazinesdiphenylhydantoinsPhrases (53)
worldly possessionsdame sybil thorndikefreudian psychologykilocycle per secondsolid body substanceamlodipine besylatefamily centriscidaefamily scorpaenidaefamily sphyraenidaeclass dicotyledonae
...View all with 18 letters...
Words (12)
polyribonucleotidesphosphatidylcholinecontradistinctivelythird-dimensionalitythree-dimensionalitymethylprednisolonesencephalomyelitidesdiethylcarbamazinestetramethyldiarsinedimethylnitrosaminedimethyltryptaminesmultidimensionalityPhrases (69)
building supply housefamily cynoglossidaeliquid body substancedisability insuranceedna st. vincent millaygerard manley hopkinserectile dysfunctiondreissena polymorphaclass chondrichthyesfamily acipenseridae
...View all with 19 letters...
Words (8)
radioimmunoassayablemagnetofluiddynamicsphenylthiocarbamidesdehydrochlorinationsphosphatidylcholinesdeoxyribonucleotidesencephalomyocarditisdimethylnitrosaminesPhrases (57)
ambystomid salamanderclassifying adjectivefriendly relationshiporder actinomycetaleslateral epicondylitissaturday night specialfederation of malaysiawilliam hyde wollastonwyethia helianthoideshymenoxys grandiflora
...View all with 20 letters...
Words (1)
encephalomyocarditisesPhrases (55)
aleksandr i. solzhenitsynhigh-density lipoproteinrhythm and blues musicianfamily branchiostomidaeedna saint vincent millayhenry engelhard steinwaydisplaying incompetencesomaliland monetary unitdepartment of philosophythoracic outlet syndrome
...View all with 22 letters...
Words (1)
phosphatidylethanolaminePhrases (35)
mary wollstonecraft godwinzollinger-ellison syndromedistinguished flying crossalexandre emile jean yersinapocynum androsaemifoliumtechnology administrationsir charles leonard woolleyoxidative phosphorylationpaul johann ludwig von heyseel salvadoran monetary unit
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (28)
francis scott key fitzgeraldedmund john millington syngereligious society of friendssir arthur stanley eddingtonreticuloendothelial systemarab revolutionary brigadesnational academy of sciencessubfamily caesalpinioideaecomplementary distributionsecond law of thermodynamics
...View all with 25 letters...
Phrases (19)
brassica oleracea gongylodescharles maurice de talleyrandgilles de la tourette syndromeconjunctival layer of eyelidsscardinius erythrophthalmusdiethylaminoethyl cellulosesuperorder labyrinthodontianontricyclic antidepressantclosed-end investment companyforce-feed lubricating system
...View all with 26 letters...
Phrases (16)
aleksandr sergeyevich pushkincommissioned military officertricyclic antidepressant drugtopical prostaglandin eyedropfalkland islands monetary unithydraulic transmission systemsysteme international d'unitesisobutylphenyl propionic acidu.s. national library of medicinethermodynamics of equilibrium
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (11)
aleksandr feodorovich kerenskytriphosphopyridine nucleotidecardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armysingle nucleotide polymorphismnonsteroidal anti-inflammatoryfield-sequential color tv systemsocial security administrationpan troglodytes schweinfurthii
...View all with 28 letters...
Phrases (14)
aleksandr nikolayevich scriabinacrylonitrile-butadiene-styreneantisocial personality disordermiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonfrancisco jose de goya y lucientespressure-feed lubricating systemsecondary sexual characteristicalfred habdank skarbek korzybski
...View all with 29 letters...
Phrases (11)
alexander isayevich solzhenitsyndepository financial institutionnontricyclic antidepressant drughenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trendsbasic point defense missile systemdisseminated lupus erythematosusacute inclusion body encephalitisoccupational safety and health act
...View all with 30 letters...
Phrases (1)
enzyme-linked-immunosorbent serologic assay