Words Containing: S,N,A,K,Y
(In Any Order)
There are 178 words,
340 phrases and
0 abbr's with
S,N,A,K,Y in.
Best Scoring Words With: S,N,A,K,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
skanky | 6 | 17 | adjectiveadj | |||||
adjective satellite • highly offensive; arousing aversion or disgust | ||||||||
swanky | 6 | 16 | adjectiveadj | |||||
adjective satellite • imposingly fashionable and elegant | ||||||||
skyman | 6 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
ryokans | 7 | 14 | nounn | |||||
noun • A traditional Japanese inn with communal baths and other public areas. | ||||||||
snakily | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
alkynes | 7 | 14 | nounn | |||||
noun • a colorless flammable gas used chiefly in welding and in organic synthesis | ||||||||
kyanise | 7 | 14 | ||||||
verb • To preserve wood from decay by soaking it in a solution of mercuric chloride | ||||||||
sneaky | 6 | 13 | adjectiveadj | |||||
adjective satellite • marked by deception • marked by quiet and caution and secrecy; taking pains to avoid being observed | ||||||||
snarky | 6 | 13 | adjectiveadj | |||||
adjective satellite • disdainfully or ironically humorous; scornful and mocking | ||||||||
snakey | 6 | 13 | adjectiveadj | |||||
adjective • Resembling or relating to snakes. • Windy; winding; twisty; sinuous, wavy. • Sly; cunning; deceitful. • Covered with serpents; having serpents. | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (29)
mistakenlystravinskyspankinglyunshakablydyskinesiaankylosaurprankishlykanamycinssneakinglygunnysacksjonnycakesskyjackingskylarkingsynkaryonsankylosingfancyworkssnakeberryhackneyismsneakishlykyrgyzstangolomynkasspeakinglynosy-parkerhandyworksprokaryonshaymakingsdandyfunksunshakenlyforsakenlyPhrases (8)
genus khayaoxygen maskoyster bankalkyd resinshank's ponyshanks' ponykansas citywhisky neatWords (31)
baryshnikovunspeakablyalkylationsplaymakingsmoneymakersbradykininsdyskinesiasstringybarkskyjackingsbrainsicklyankylosaursmythmakingsjohnnycakesthanklesslychelyabinskspiny-backedkyanisationhackneyismssnakeblennykyrgyzstaniarkansawyernosey-parkerskylarkingsjaywalkingssynkaryonicgrayish-pinkkarstifyingsqueakinglyunshakeablysparklinglykinesipathyPhrases (8)
glossy snakewhiskey neatnoam chomskythorny skatebrass monkeyhans eysencksubway tokensoybean milkWords (25)
unmistakablystanislavskyankylosaurusmoneymakingshyperkinesiamerrymakingsbricklayingsstringybarkstracklayingskaryokineseskaryokinesiskeyboardingsgallygaskinsbradykinesiakyanisationskyanizationsstravinskyankeynesianismalkalescencyladylikenessmarrowskyingpancake-stylechimneystackcycloalkaneskidney-shapedPhrases (14)
shaking palsya. noam chomskystock companyalfred kinseydenmark veseyhockey seasonsoaking syrupaum shinrikyokey signaturenew york aster
...View all with 12 letters...
Words (13)
painstakinglyhyperkinesiasheterokaryonsbradykinesiasstickybeakingfairnyticklescryoplanktonsdostoyevskianunmistakeablyankyloglossiakenyapithecuskinesitherapyshockumentaryPhrases (26)
el iskandriyahthree kings' daybanking systemvan wyck brooksrayon stockingryukyu islandstank destroyergenus kennedyagenus boykiniasnake polypody
...View all with 13 letters...
Words (9)
phytoplanktersankylosaurusesearthshakinglycantankerouslyphytoplanktonshydrocrackingsblackberryingsyekaterinoslavladylikenessesPhrases (27)
igor stravinskydynamic speakerkeynote addressostyak languagestanley kubrickanthony hopkinsblack-eyed susansir john hawkynswaslaw nijinskydesk dictionary
...View all with 14 letters...
Words (1)
alkylbenzenesulfonatePhrases (23)
nikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynsri lankan monetary unitisle royal national parksoren aabye kierkegaardpakistani monetary unitthomas kennerly wolfe jr.kurdistan workers partykurdistan workers' party
...View all with 21 letters...
Phrases (12)
igor fyodorovich stravinskyfrancis scott key fitzgeraldtrans-alaska pipeline systemandrei arsenevich tarkovskypodkamennaya tunguska rivercygnus columbianus bewickiichamaecyparis nootkatensisfederal home loan bank systemhenry kenneth alfred russellcommunist party of kampuchea
...View all with 25 letters...
Phrases (1)
employee stock ownership planPhrases (1)
technical analysis of stock trendsPhrases (1)
great smoky mountains national parkPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay