Words Containing: S,H,Y,N
(In Any Order)
There are 2,428 words,
1,986 phrases and
0 abbr's with
S,H,Y,N in.
Best Scoring Words With: S,H,Y,N
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| zanyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| sphynx | 6 | 21 | nounn | |||||
noun • Alternative form of Sphynx | ||||||||
| hyphens | 7 | 18 | nounn | |||||
noun • a punctuation mark (-) used between parts of a compound word or between the syllables of a word when the word is divided at the end of a line of text verb • divide or connect with a hyphen | ||||||||
| honkeys | 7 | 17 | nounn | |||||
noun • (slang) offensive names for a White man | ||||||||
| menschy | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| hunkeys | 7 | 17 | ||||||
Valid word for Scrabble US
| ||||||||
| nymphos | 7 | 17 | nounn | |||||
noun • a woman with abnormal sexual desires | ||||||||
| hryvnas | 7 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| synched | 7 | 16 | verbv | |||||
verb • To synchronize, especially in the senses of data synchronization, time synchronization, or synchronizing music with video. • To flush all pending I/O operations to disk. | ||||||||
| unshowy | 7 | 16 | adjectiveadj | |||||
adjective • Not showy; plain or unassuming | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (104)
honestlysymphonyhypnosisshenyangpsychingyoungishsydenhamscythiansunshinycushionydandyishphantasyhyoscinechymosinstanchlygreyhensvarnishyscythingsyphonedhyalineshymnistsninnyishgryphonsunflashychutneyshydrantshomonymstyphoonsshanteyshalcyonsathanasychimneyssynchrossynthpopspinachy
...View all with 8 letters...
Phrases (6)
sea nymphon the slydowny ashby inchesbony fishtyan shanWords (192)
physiciansyntheticpantyhosehypnotistsynthesisshimmyingunsightlyhypnotismhygienistsymphonicheinouslyhypnotiseyachtsmanhusbandrysycophantanywhereshesitancystaunchlysynchronysisypheandashinglyunshapelyhomeynessanhydroushusbandlyhemolysinunstylishknavishlyhygienicshymenealsshininglyshinnyinghypnoticssypheringhoneypots
...View all with 9 letters...
Phrases (15)
shy personhush moneyyoung fishgenus hylahudson bayh. j. eysenckwelsh ponyh.m.s. bountythe skinnyjohn davys
...View all with 9 letters...
Words (291)
handsomelydishonestyshockinglyhieronymusstrychninescathinglynewsworthyhypotenuseshantytownsynecdochesynthesizehypnotiseddisharmonysmashinglyhypertensefiendishlysynthesisehypersonicsoothinglycrashinglyunshakablyclownishlymyastheniacrushinglyhesitantlysynchronicsycophancysynchronallengthwayssnobbishlysynthesistphenocrystxylophoneskeypunchesprankishly
...View all with 10 letters...
Phrases (32)
moshe dayangenus khayajohn wesleywendy housespanish flygenus physahenry jamesgenus typhalay hands onhelen hayes
...View all with 10 letters...
Words (336)
synchronizesynthesizerfashionablyhoneysucklebaryshnikovsynchronoushydroponicssynesthesiasynthesizedschenectadyunabashedlyphysiognomyrhinoplastydishonestlymonkeyshinesycophanticxylophonistnasopharynxhypotensiveunashamedlysynchroniseunselfishlyslightinglysoothsayingsynchromeshmisanthropyravishinglyanaphylaxisnonphysicalscenographyhypotensionyevtushenkoyesternightsynthesiserpsychogenic
...View all with 11 letters...
Phrases (57)
sensory hairdylan thomasanise hyssophenry hudsonthymus glandgenus ophryscherry stonegenus hyaenanorth by westjoseph haydn
...View all with 11 letters...
Words (354)
christianitysynchronizedasphyxiationbiosynthesishypertensionposthypnoticrefreshinglyhypertensivepyrotechnicsharmoniouslysynchronisedyouthfulnessthunderouslydishonorablyhypogonadismhorrendouslyasynchronoushypnotisablephysiognomicdysmenorrheasynthesizingasphyxiatingsynaesthesiasympathisingsynchronizersolzhenitsynhesitatinglyautohypnosissuperhumanlystonyheartedphysicalnessbeseechinglytyrothricinsbiosynthetichyperintense
...View all with 12 letters...
Phrases (76)
mrs. henry woodshaking palsychinese deityphantasy lifehoneyed wordsstring theorygenus halcyonarthur symonsrhesus monkeya. noam chomsky
...View all with 12 letters...
Words (315)
psychoanalystchrysanthemumuntrustworthyastonishinglynorthwesterlyunsympatheticpsychoanalyzedehydrogenaseneurosyphilissynchronicityantipsychoticsynchronisingsyntheticallysynchronizingphysostigminehypothesisingsyphilizationhydrodynamicsnightmarishlysynchronisticadmonishinglypsychoanalysepsychokineticnortheasterlyhypothesizingunfashionablydishonourablypsychokinesisinexhaustiblypsychogenetichyaluronidasephagocytosingstylishnessestheophyllineshoneycreepers
...View all with 13 letters...
Phrases (93)
harvey cushingel iskandriyahnursery schoolgenus nymphaeasphyrna tiburosunday clothesmexican hyssopthree kings' daygenus thomomysgenus physeter
...View all with 13 letters...
Words (269)
psychoanalysishypersensitivephotosynthesisthermodynamicspsychoanalyticchemosynthesispsychoneuroticgeosynchronousnarcosynthesispsychodynamicsunsynchronizedpyelonephritisasynchronouslypsychoneurosisphotosyntheticchemosynthetichydrocortisoneanesthesiologyunhesitatinglycomprehensiblythyroglobulinsbutyrophenonesaminophyllineshypermasculinedehydrogenasespsychoanalysespsychoanalyzedpsychoanalyzesmetaphysicianspyrimethamineshedonisticallysycophantishlypsychologizingnonhygroscopicphytoplankters
...View all with 14 letters...
Phrases (128)
anthony burgessyellowish brownbusman's holidaysymphonic musicblended whiskeychinese parsleyjapanese cherrygenus nymphicusgenus chrysaoragenus pyrethrum
...View all with 14 letters...
Words (204)
synchronizationanaesthesiologysynchronisationsuccinylcholineneurophysiologyphotosynthesizeneuropsychiatrycomprehensivelyultrasonographykinestheticallyadenohypophysishypersensitizedneurohypophysisheterogeneouslymethylxanthinespsychoanalyzingdisenchantinglypsychohistoriansycophanticallydishearteninglyhypersalivationpsychometriciandistinguishablycyproheptadineshypersomnolenceautochthonouslypsychosynthesishypervigilanceshyposensitizingethnomusicologyionosphericallyphosphorylatingphosphorylationhyperinflationshyperinsulinism
...View all with 15 letters...
Phrases (169)
helen wills moodydialysis machinewystan hugh audenjohn quincy adamshyoscyamus nigerspiny-headed wormscholarly personhoneymoon resortshorthand typistmythical monster
...View all with 15 letters...
Words (104)
enthusiasticallyincomprehensiblypsychoanalyticalsphygmomanometerhypersensitivityneuropsychiatrichypersalivationsinextinguishablyantistrophicallyspondylarthritishypersensitizinginexhaustibilityhypersomnolenceshyperstimulatinghyperstimulationapocryphalnesseshypervitaminosessphygmomanometryglossopharyngealnonpsychiatristsarchaeoastronomynonpsychologicalthyrocalcitoninsmonotheisticallyhypostatizationsstenographicallyephippiorhynchusstereophonicallyphotosensitivitycyanoethylationscyclohexylamineslymphogranulomaskinaestheticallycytotechnologiescytotechnologist
...View all with 16 letters...
Phrases (182)
christian huygensgenus crotaphytuschemical analysisacross the countrynevil shute norwaymechanical systemschool dictionarynervus hypoglosuspharyngeal tonsilgenus xyphophorus
...View all with 16 letters...
Words (51)
neurophysiologistpsycholinguisticsspondylolisthesishyperstimulationshyperventilationssphygmomanometershypnotizabilitiesthrombocytopeniashyposensitizationencephalomyelitislymphadenopathiescytotechnologistsphenylethylaminestransthoracicallydehydrochlorinaseglossopharyngealstriiodothyroninestriphenylmethanesneurophysiologiesgynandromorphismsneuropsychiatriesneuropsychiatristneuropsychologiesneuropsychologistunsympatheticallymesembryanthemumsdesynchronisationdesynchronizationcomprehensibilityanachronisticallydephosphorylatingdephosphorylationrhynchocephalianspseudoparenchymasschizophrenically
...View all with 17 letters...
Phrases (190)
division bryophytainterstate highwaysubphylum craniatagenus symphalangusantipsychotic drugprimary censorshipcalycanthus familytypha angustifoliaanas platyrhynchospython reticulatus
...View all with 17 letters...
Words (49)
hyperaldosteronismneuropsychologicalhypersensitivenessmethyltestosteronehypersensitivitieshypersensitizationpolymorphonuclearsnoncomprehensivelysphygmomanometrieshypophysectomizinghyposensitizationslaryngopharyngitisperchloroethylenespostpsychoanalytictriphosphopyridinelymphangiographiesdistinguishabilitydehydrochlorinasesdehydrochlorinatestrichloroethylenesaerothermodynamicsneurophysiologistsneuropsychiatristsneuropsychologistsdemythologizationsheavyheartednessesmethylnaphthalenesmethylprednisolonedephosphorylationsrhinolaryngologistpseudoparenchymatachlortetracyclinespsychoanalyticallyphotosyntheticallycytoarchitectonics
...View all with 18 letters...
Phrases (169)
division anthophytadame sybil thorndikelachrymal secretionfreudian psychologyantipsychotic agentgenus chamaecytisuscrataegus oxycanthapolish monetary unitdylan marlais thomasgenus archaeopteryx
...View all with 18 letters...
Words (23)
hypersensitizationscytopathogenicitiesimmunocytochemistryphenomenalisticallyphosphatidylcholinephosphoenolpyruvatethird-dimensionalityhysterosalpingogramthree-dimensionalitymethylcholanthrenesmethylprednisolonesincomprehensibilityencephalomyelitidesdihydrostreptomycindiethylcarbamazinesphytohemagglutininshyperconcentrationstetramethyldiarsinehypoadrenocorticismdimethylnitrosaminehyperemotionalitiesdimethyltryptaminesexhibitionisticallyPhrases (158)
building supply housejohn millington syngehydrastis canadensisgiles lytton stracheydivision schizophytagenus cryptobranchusgenus symphoricarposcalycanthus floriduschinese monetary unitbritish capacity unit
...View all with 19 letters...
Words (26)
uncharacteristicallyoverenthusiasticallyhypersensitivenesseslipochondrodystrophyhyperadrenocorticismindistinguishabilitylymphogranulomatoseslymphogranulomatosisphenylpropanolaminesphenylthiocarbamidesacetylcholinesteraseoophorosalpingectomydehydrochlorinationsphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallymagnetohydrodynamicshistoincompatibilityimmunohistochemistryencephalomyocarditisphotophosphorylationpseudoparenchymatouspalatopharyngoplastyhyperconsciousnessesdimethylnitrosaminesPhrases (135)
balaenoptera physalusdivision tracheophytabalance sheet analysisdianthus caryophyllusmechanically skillfulmilton snavely hersheyfriendly relationshipsouth american countryluscinia megarhynchosa-scan ultrasonography
...View all with 20 letters...
Words (6)
otorhinolaryngologistimmunocytochemistriesacetylcholinesterasesotorhinolaryngologiesphotophosphorylationstetrahydrocannabinolsPhrases (107)
igor ivanovich sikorskyaleksandr solzhenitsynparty to the transactionstrawberry haemangiomahenry hobson richardsonspeech intelligibilityhans holbein the youngersyngnathus hildebrandiphylum platyhelminthesacanthocybium solandri
...View all with 21 letters...
Words (3)
intercomprehensibilityotorhinolaryngologistsencephalomyocarditisesPhrases (101)
aleksandr i. solzhenitsynhigh-density lipoproteinrhythm and blues musicianfamily branchiostomidaejohns hopkins universityhenry engelhard steinwaychrysanthemum balsamitadepartment of philosophybahasa malaysia languageseychelles monetary unit
...View all with 22 letters...
Words (1)
hexamethylenetetraminesPhrases (81)
family threskiornithidaekazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusbangladeshi monetary unitsouth korean monetary unittyrosine kinase inhibitorrichard brinsley sheridansearch and destroy missionornithorhynchus anatinus
...View all with 23 letters...
Words (2)
laryngotracheobronchitisphosphatidylethanolaminePhrases (60)
argyroxiphium sandwicensedivision heterokontophytadistinguished flying crossexistentialist philosophytechnology administrationhypersensitivity reactionmohorovicic discontinuityhenry wadsworth longfellowsir charles leonard woolleychrysosplenium americanum
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesuvulopalatopharyngoplastyPhrases (50)
embryonal rhabdomyosarcomaigor fyodorovich stravinskymary wollstonecraft shelleyedmund john millington syngemelanerpes erythrocephalusbeggar-my-neighbour strategysir arthur stanley eddingtonmichelson-morley experimentandrei arsenevich tarkovskysudden infant death syndrome
...View all with 25 letters...
Phrases (35)
hunting and gathering societyhuman immunodeficiency virusemployee stock ownership planevelyn arthur saint john waughcharles maurice de talleyrandsubdivision coniferophytinanewton's theory of gravitationsystem of weights and measuresbenign prostatic hyperplasiapalestine national authority
...View all with 26 letters...
Phrases (29)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinaugustus welby northmore puginpull the wool over someone's eyesdeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtenstein
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (23)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotidemarcus junius brutus the youngerdepartment of homeland securitydissident irish republican armycount lev nikolayevitch tolstoysingle nucleotide polymorphismaspidophoroides monopterygiuspalestinian national authority
...View all with 28 letters...
Phrases (10)
aleksandr nikolayevich scriabindisorganized type schizophreniasao thome e principe monetary unithydrangea macrophylla hortensispresident william henry harrisonarrhenius theory of dissociationsecondary sexual characteristicalfred habdank skarbek korzybskicontinuity irish republican armythelypteris palustris pubescensPhrases (14)
battle of spotsylvania court housebattle of spotsylvania courthousealexander isayevich solzhenitsynbachelor of arts in library sciencewaterhouse-friderichsen syndromemucocutaneous lymph node syndromehenri rene albert guy de maupassantdryopteris thelypteris pubescenstechnical analysis of stock trendsprovisional irish republican army
...View all with 30 letters...
Phrases (13)
nikolai andreyevich rimski-korsakovhierarchical classification systemsergei aleksandrovich koussevitzkynikolai andreyevich rimsky-korsakovtheory of electrolytic dissociationoculopharyngeal muscular dystrophylymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoprogressive emphysematous necrosisattorney general of the united states
...View all with 32 letters...
Phrases (8)
right to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scannersubacute inclusion body encephalitisamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (1)
respiratory distress syndrome of the newborn
