Words Containing: S,H,R,I
(In Any Order)
There are 12,230 words,
6,082 phrases and
0 abbr's with
S,H,R,I in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
scherzi | 7 | 21 | nounn | |||||
noun • A piece of music or a movement from a larger piece such as a symphony; especially, a piece of music played in a playful manner. | ||||||||
hijrahs | 7 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
zithers | 7 | 19 | nounn | |||||
noun • a musical stringed instrument with strings stretched over a flat sounding board; it is laid flat and played with a plectrum and with fingers | ||||||||
shikker | 7 | 18 | noun, adjectiven, adj | |||||
noun • Drunk, drunkard | ||||||||
whisker | 7 | 17 | nounn | |||||
noun • a very small distance or space • a long stiff hair growing from the snout or brow of most mammals as e.g. a cat verb • furnish with whiskers | ||||||||
shrimpy | 7 | 17 | adjectiveadj | |||||
adjective satellite • (used especially of persons) of inferior size | ||||||||
rikshaw | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
shrieky | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
hejiras | 7 | 17 | nounn | |||||
noun • a journey by a large group to escape from a hostile environment • the flight of Muhammad from Mecca to Medina in 622 which marked the beginning of the Muslim era; the Muslim calendar begins in that year | ||||||||
sheriff | 7 | 16 | nounn | |||||
noun • the principal law-enforcement officer in a county | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (395)
historysheriffbritishthirstysharingworshipturkishkrishnawhisperrushingcherishcashierchristykashmirkurdishfischerostrichheroismheiressvarnishparrishheroicsnourishairshipfurnishmoorishshimmergirlishshriveltarnishwarshipreddishdervishwithersfishery
...View all with 7 letters...
Phrases (5)
air hoseusher inin shortrose hipfish fryWords (779)
straightharrisoncrashinghistoriccrushinglordshiparchiveshardshipchristierichardsbrushingcharismarickshawhysteriaflourishwhiskersperishedgraphicswhistlersheridanthirtiesdishonorshipyardbritchesfeverishsapphirestarfishschillerhairlessirishmanrichnessshowgirlchristengershwinskirmish
...View all with 8 letters...
Phrases (27)
old irishfish lureby rightspoor fishair shaftbird shotsushi barchin resthard signworm fish
...View all with 8 letters...
Words (1267)
christmasotherwisechristiansearchingchemistrytherapisthilariousrighteousdischargepublisherfishermanhiroshimawhisperedownershipshiveringshriekinggibberishhairstylehypocrisyfranchiseanarchisthistoriancherishedthrashingshrinkingarthritisravishingstarlightyorkshireshipwreckoversighthampshirecourtshipfirsthandfirehouse
...View all with 9 letters...
Phrases (92)
irish mosshair slidehair stylesick berthfalse hairscotch firant shrikejust rightartie shawcargo ship
...View all with 9 letters...
Words (1690)
friendshipwhisperingscreechinghistoricalstraightenleadershiphystericaldischargedrehearsingscratchingrefreshingmembershipstretchingworshippedpittsburghshatteringcensorshippharmacistarchbishopinternshipdishwasherhemisphereantichristdistraughtpsychiatryrichardsonschoolgirlbrightnesseisenhowerrhinocerospurchasingsweatshirtwinchesterhydraulicsdispatcher
...View all with 10 letters...
Phrases (167)
shah of iranushering inthin personstrike hardbreed's hillair marshalirish gorsechoir stallhorse grainthree times
...View all with 10 letters...
Words (1873)
authoritiesscholarshipchristopherpsychiatricphilosopherpartnershiphairdressermerchandiseprehistoricbrainwashedatmosphericcharismaticnourishmentchristeningsponsorshipaphrodisiachemorrhoidsswitchboardhorseradishflourishingsmithereenssynchronizesynthesizerworkmanshipfurnishingsstreetlightreestablishunrighteouschristendomchiaroscurobaryshnikovmisanthropeschrodingerarchdiocesemesomorphic
...View all with 11 letters...
Phrases (259)
tribal sheikriding horserubbish heapgreat schismweather sidesir john rosssurface shiphigh spiritssensory hairhigh treason
...View all with 11 letters...
Words (1829)
relationshippsychiatristchristianitydictatorshipcatastrophicextinguisherstraightawayheadmistresssynchronizedhistoricallybloodthirstybrainwashinghousewarminghairdressingarcheologisthystericallyimpoverishedapprehensionapprehensivebiochemistryguardianshiporthodontistdishonorablehypertensiondisheartenedunauthorisedmarksmanshipdisinheritedphrenologistspeechwriterheartstringsmalnourishedrefreshinglyastrophysicshypertensive
...View all with 12 letters...
Phrases (328)
tribal sheikhgrain sorghumbill of rightsstar sapphirebabe zahariasweaver's hitchchristmas boxmissel thrushirish capitalchristmas day
...View all with 12 letters...
Words (1520)
schizophreniarighteousnessschizophrenicarchaeologistcomprehensioncomprehensiveswordsmanshipstrengtheningmetamorphosiscraftsmanshiphieroglyphicsmerchandisingreprehensibleauthorisationsportsmanshipchristmastimephysiotherapydishonourablehyperhidrosisornithologistorchestratingwhithersoeverprofessorshiprefurbishmenthairsplittingneurosyphilishertfordshireforeshadowingsynchronicityboardinghouseanachronisticcharacterisedtransthoracicsynchronisingthermoplastic
...View all with 13 letters...
Phrases (419)
harvey cushingel iskandriyahgenus struthiophillips screwlouis the greatfrances wrightephedra sinicasandwich boardspecial branchrough sledding
...View all with 13 letters...
Words (1150)
characteristicclaustrophobicanthropologistapprenticeshipclaustrophobiaphilanthropisthypersensitivecomprehensibleastrophysicistschoolchildrenthermodynamicscholinesteraseundernourishedwhippersnapperpsychoneuroticstraightjacketnarcosynthesismicrochemistryrelinquishmentschoolmistressosteoarthritishorticulturistpharmacologistworcestershirespectrographicunsynchronizedimpoverishmentphantasmagoriahypothyroidismheadmastershipdisenfranchisepyelonephritiselectrochemistcharacterisingdisinheritance
...View all with 14 letters...
Phrases (442)
breathing spacebreathing spellsilver chlorideauf wiedersehensir john tennielcastle in the airsir joseph banksmyrrhis odoratayellowish brownischemic stroke
...View all with 14 letters...
Words (811)
straightforwardpsychotherapistsynchronizationpithecanthropusdisenfranchisedphotojournalistphysiotherapistheterosexualitymisapprehensionparthenogenesiselectrophoresisphotojournalisminterscholasticforesightednessgloucestershirepseudoephedrinesynchronisationenfranchisementtrustworthinessneurophysiologystereochemistrypulchritudinousunrighteousnessdistributorshipnearsightednessincomprehensionhumanitarianismneuropsychiatryatherosclerosispsychiatricallycomprehensivelyincomprehensivetroubleshootingimperishabilitychurrigueresque
...View all with 15 letters...
Phrases (505)
president hooverhigh renaissancecaltha palustrissir john herscheltheodore dreisersir john vanbrighnewton's third lawbelgian shepherdsodium hydroxidehundred-and-first
...View all with 15 letters...
Words (289)
incomprehensibleincomprehensiblyaustralopithecuscatastrophicallyshortsightednessentrepreneurshipundernourishmentuncharacteristicerythroblastosisrhinosporidiosisthermostaticallyelectrochemistryanthropomorphismcharacterisationhypersensitivityoverenthusiasticlightheartednessanthropomorphiseparapsychologistauthoritarianismneuropsychiatricnorthamptonshirethermolabilitieshypersalivationsmiscomprehensionradiochemistriesspectroheliogramuncomprehensibleantistrophicallydisenfranchisingspondylarthritishypersensitizingthermoperiodismshypersexualitiespraiseworthiness
...View all with 16 letters...
Phrases (492)
president johnsonchristian huygenssonic depth findergenus istiophorusochotona princepswinston churchillmephitis macrouranorthern rhodesiaself-evident truthsir richard burton
...View all with 16 letters...
Words (149)
straightforwardlytriskaidekaphobianeurophysiologistcomprehensivenesspsychotherapeuticinterrelationshiphyperreactivitiesradioautographiesantischizophreniaantischizophrenicmiscomprehensionsthermoluminescentphysiotherapeuticspectroheliogramsspectroheliographspectrohelioscopecommissionershipskindheartednesseshyperstimulationsthermoregulationsdisfranchisementsparapsychologistsradiotelegraphiesinheritablenessesthermostabilitieshyperventilationsthrombocytopeniasapproachabilitiescrashworthinessesunrighteousnessesarchconservativesstereochemistriescontradistinguishcrystallographiesimmunochemistries
...View all with 17 letters...
Phrases (529)
horizontal sectiongopherus agassiziidivision bryophytacivil rights leaderjohn moses browningacherontia atroposhandicapped personshipwreck survivorwilliam wordsworthinterstate highway
...View all with 17 letters...
Words (124)
characteristicallyspectrophotometrichyperaldosteronismdisenfranchisementneuropsychologicalthermoluminescencehypersensitivenesshypersensitivitieshypersensitizationradiochromatogramsspectroheliographsspectroheliographythermoplasticitiesspectrohelioscopesnoncomprehensivelyinharmoniousnessesdishonorablenessesfaintheartednessesmonochromaticitiespsychotherapeuticsapprehensivenessessphygmomanometriesarchaeoastronomiesthrombophlebitideshypoparathyroidismcreditworthinessesrechromatographieslaryngopharyngitislightheartednesseslipopolysaccharidetriphosphopyridinecomprehensiblenessastrophotographiesstereophotographiclymphangiographies
...View all with 18 letters...
Phrases (507)
genus struthiomimusheat of vaporisationfamily physeteridaeorthotomus sutoriusdame sybil thorndikelachrymal secretionfreudian psychologyedgar rice burroughsmoschus moschiferustheodosius the great
...View all with 18 letters...
Words (77)
hyperparathyroidismpseudohermaphroditestraightforwardnessthermoluminescencesdisenfranchisementsthermoperiodicitieshypersensitizationshypersusceptibilityspectrophotometriesparathyroidectomieshypoparathyroidismsmucopolysaccharideslipopolysaccharidescomprehensibilitiescomprehensivenessesstereophotographiesresorcinolphthaleinanarcho-collectivismauthoritativenessesimmunocytochemistrydiethylstilbesteroldiethylstilboestrolelectrocardiographsphonocardiographieschromoblastomycosisneuropharmacologiesphosphofructokinaseneuropharmacologistreprehensiblenessesthird-dimensionalitycontradistinguishedcontradistinguisheshysterosalpingogramthree-dimensionalityphotodisintegrating
...View all with 19 letters...
Phrases (437)
civil rights activisthydrastis canadensisallium schoenoprasumread between the linesgiles lytton stracheygenus symphoricarposhaliotis tuberculatahelianthus tuberosusteacher's certificatepounds per square inch
...View all with 19 letters...
Words (61)
uncharacteristicallyhypercholesterolemiaoverenthusiasticallyparadichlorobenzenessemiautobiographicalhypersensitivenessesspectroheliographiesradiopharmaceuticalsspectrophotometricallipochondrodystrophycrystallographicallyhyperadrenocorticismcomprehensiblenesseslymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesinterchangeabilitiesphiloprogenitivenessacetylcholinesterasepseudohermaphroditicoophorosalpingectomyglomerulonephritidesdehydrochlorinationsphosphofructokinasesneuropharmacologistsneurophysiologicallyneuropsychiatricallycontradistinguishingmagnetohydrodynamicselectrooculographiesphotodisintegrationselectrophotographieselectrophysiologicalelectrophysiologists
...View all with 20 letters...
Phrases (370)
suborder strepsirhiniarcheological remainsgilbert charles stuartyellow-shafted flickerphotographic emulsionsecond coming of christbusiness relationshipdivision tracheophytastephen collins fostersagittarius the archer
...View all with 20 letters...
Words (26)
psychopharmacologicaldisestablishmentarianotorhinolaryngologisthypersusceptibilitiesimmunocytochemistriesstraightforwardnessesimmunoelectrophoresesmucopolysaccharidosisestablishmentarianisminterchangeablenesseselectrocardiographiesacetylcholinesterasespseudohermaphroditismadrenocorticotrophinsotorhinolaryngologiesimmunoelectrophoresiselectroretinographiesanthropomorphizationsincomprehensibilitiesantiauthoritarianismspseudocholinesterasesphotophosphorylationshypercholesterolemiaspsychopharmacologistspsychotherapeuticallytetrahydrocannabinolsPhrases (325)
acrocentric chromosomesir john everett millaisadministrative hearingcercopithecus aethiopshelianthemum scopariumanaphalis margaritaceaigor ivanovich sikorskyaleksandr solzhenitsynanthriscus cereifoliumhelichrysum bracteatum
...View all with 21 letters...
Words (12)
disestablishmentariansspectrophotometricallyimmunohistochemistriesphiloprogenitivenessesintercomprehensibilityotorhinolaryngologistselectrophysiologicallyincomprehensiblenessesencephalomyocarditisesestablishmentarianismsmicrospectrophotometermicrospectrophotometryPhrases (277)
gilbert keith chestertonhaliaeetus leucorhyphusleishmaniasis americanaaleksandr i. solzhenitsynviola tricolor hortensisinstrument of punishmentteacher-student relationfrancis richard stocktonsodium tripolyphosphatehigh-density lipoprotein
...View all with 22 letters...
Words (3)
hexamethylenetetraminesmicrospectrophotometersmicrospectrophotometricPhrases (188)
family threskiornithidaeparenthetical expressiontransient ischemic attacktribasic sodium phosphatesir richard francis burtonkazakhstani monetary unitthryothorus ludovicianuschristoph willibald gluckaristolochia serpentariaright of first publication
...View all with 23 letters...
Words (6)
laryngotracheobronchitisintercomprehensibilitieselectroencephalographiesdichlorodifluoromethanesmicrospectrophotometriesschizosaccharomycetaceaePhrases (158)
pelham grenville wodehouseargyroxiphium sandwicensedivision heterokontophytatrip the light fantastic toeprimary sex characteristicbattle of the spanish armadabrassica oleracea acephaladistinguished flying crossadolf otto reinhold windausarthur meier schlesinger jr.
...View all with 24 letters...
Words (1)
antiestablishmentarianismPhrases (108)
igor fyodorovich stravinskysymphoricarpos orbiculatuscruel and unusual punishmentdistinguished service medalfriedrich wilhelm nietzscheboris leonidovich pasternakmodest petrovich mussorgskyrudolf christian karl dieselwar of the spanish successionproprietorship certificate
...View all with 25 letters...
Phrases (88)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidsir sarvepalli radhakrishnanalternanthera philoxeroideshunting and gathering societywar of the austrian successionanton grigorevich rubinstein
...View all with 26 letters...
Phrases (67)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkinelectromechanical transduceraugustus welby northmore pugindirector-stockholder relationfreedom from search and seizurejerusalem artichoke sunflowerthyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenko
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (65)
aleksandr feodorovich kerenskyephippiorhynchus senegalensistriphosphopyridine nucleotidemarcus junius brutus the youngergallinula chloropus cachinnansfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskydistinguishing characteristicthird council of constantinoplejohan julius christian sibelius
...View all with 28 letters...
Phrases (39)
aleksandr nikolayevich scriabinchemical decomposition reactionfriedrich wilhelm august froebeldisorganized type schizophreniadmitri dmitrievich shostakovichsouth-central dravidian languagecapital of the russian federationsao thome e principe monetary unitferdinand joseph la menthe mortoncongregational christian church
...View all with 29 letters...
Phrases (32)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovaalexander isayevich solzhenitsynbachelor of arts in library sciencedouble standard of sexual behaviorjacques anatole francois thibaultrepublic of bosnia and herzegovinaaleksandr mikjailovich prokhorovaugust friedrich leopold weismann
...View all with 30 letters...
Phrases (26)
united states public health servicebureau of intelligence and researchmarie louise elisabeth vigee-lebrunsir john frederick william herschelfrances elizabeth caroline willardchickasaw national recreation areaposterior vein of the left ventricleanicius manlius severinus boethiusprimary subtractive color for lightoscar fingal o'flahertie wills wilde
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (20)
nikolai andreyevich rimski-korsakovafrican american vernacular englishhierarchical classification systemsergei aleksandrovich koussevitzkystraight-line method of depreciationnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylateprimary subtractive colour for lighttheory of electrolytic dissociation
...View all with 32 letters...
Phrases (18)
characteristic root of a square matrixbreach of trust with fraudulent intentbureau of alcohol tobacco and firearmsorganization of the oppressed on earthelizabeth cleghorn stevenson gaskellmusculus sphincter ductus choledochisir winston leonard spenser churchillright to speedy and public trial by jurykonstantin sergeyevich stanislavskydisease of the neuromuscular junction
...View all with 33 letters...
Phrases (15)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzdryopithecus rudapithecus hungaricusdepartment of health and human servicesbaron hugh caswall tremenheere dowding
...View all with 34 letters...
Phrases (10)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentcomte donatien alphonse francois de sadehereditary motor and sensory neuropathychristopher william bradshaw isherwoodtransurethral resection of the prostatesubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorunited states naval research laboratoryPhrases (10)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorchurch of jesus christ of latter-day saintsfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelsecretary of health education and welfarealbrecht eusebius wenzel von wallensteinsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberPhrases (9)
sisters of the order of saint basil the greatfirst epistle of paul the apostle to timothytheodore roosevelt memorial national parkuniversity of north carolina at chapel hillattention deficit hyperactivity disordersecretary of housing and urban developmentkarl friedrich hieronymus von munchhausencongregation of the sisters of saint hedwigsupreme headquarters allied powers europe