Words Containing: S,H,M,E
(In Any Order)
There are 6,427 words,
3,569 phrases and
1 abbr with
S,H,M,E in.
Best Scoring Words With: S,H,M,E
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
shmooze | 7 | 21 | verbv | |||||
noun • (Yiddish) a warm heart-to-heart talk verb • talk idly or casually and in a friendly way | ||||||||
exhumes | 7 | 19 | verbv | |||||
verb • dig up for reburial or for medical investigation; of dead bodies | ||||||||
mikvehs | 7 | 19 | nounn | |||||
noun • A ritual bath in which various Jewish purifications are performed. | ||||||||
homosex | 7 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
whimsey | 7 | 18 | nounn | |||||
noun • an odd or fanciful or capricious idea • the trait of acting unpredictably and more from whim or caprice than from reason or judgment | ||||||||
mayhems | 7 | 17 | nounn | |||||
noun • the willful and unlawful crippling or mutilation of another person • violent and needless disturbance | ||||||||
menschy | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
chymes | 6 | 16 | nounn | |||||
noun • a semiliquid mass of partially digested food that passes from the stomach through the pyloric sphincter into the duodenum | ||||||||
hakeems | 7 | 16 | ||||||
noun • a Muslim physician | ||||||||
samekhs | 7 | 16 | nounn | |||||
noun • the 15th letter of the Hebrew alphabet | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (192)
himselfsomehowashamedsmashedmessiahshermanhamsterchemistmemphismarchessmotherheroismflemishthermosshimmeratheismblemishsmasherschmearishmaelhumerusschemergreshammushiergumshoemishearschmeerchemisebeamishshamblemeshingmeshugashmoozewhimseyhomines
...View all with 7 letters...
Phrases (2)
sea holmgym shoeWords (443)
handsomehomelesssomewhatharmlesschambersfreshmanmustacheshamefulshipmentmischiefshowtimedemolishhorsemanmorpheushomesickmadhousefamishedemphasisschemingmoonsheeshamblessmoothercashmeresmoothiememsahibmachetesmethinksheadsmanseraphimhousemanrushmoresondheimherdsmansmoothedhedonism
...View all with 8 letters...
Phrases (16)
mess hallsea nymphmash beanmarsh hengame fishshow timefish mealhead smuthome basehemp seed
...View all with 8 letters...
Words (662)
somethingsomewherechemistrymoustacheshamelessfishermanmechanicsmechanismblasphemysophomorefarmhouseemphasizemoonshinehampshirewholesomemisbehavealchemistsmotheredmilkshakebombshelleuphemismhousemaidsqueamishmightiestshoemakermakeshiftcatechismemphysemaloathsomemcphersonblasphemehomesteadgilgameshsmoothiesmethodist
...View all with 9 letters...
Phrases (64)
sketch mapmale horsetest matchamish sectsolo homermarsh fernmarsh harehush moneychess gamegenus homo
...View all with 9 letters...
Words (882)
themselvespunishmentatmospherehomosexualmanchesterenthusiasmheadmasterharassmentmembershipstepmotherenglishmandemolishedhemispheresympathizesuperhumandiminishedchromosomeprometheusschoolmaterheumatismbothersomehandsomelymisbehavedmotherlesssmotheringhieronymusarchimedesbanishmentblasphemerthermostatfishmongeremphasizedhandsomestsympathisepenmanship
...View all with 10 letters...
Phrases (79)
white camasmoshe dayanslim chancemt. st. helenssam shepardshame plantsmart phoneall the samethree timesmarsh cress
...View all with 10 letters...
Words (978)
mathematicsmerchandisesympatheticmischievousscaramoucheatmosphericstomachachenourishmentrefreshmenthemorrhoidsshamelesslysmithereensdemolishingblasphemousmisbehavingmetaphysicshomestretchchristendommisanthropemustachioedmesomorphichousemastersummerhouseathleticismspeechmakersympathizerunblemishedmendelssohnbumbershootgarnishmenthomesteadermisbehaviorcomradeshipblaspheminghomeostasis
...View all with 11 letters...
Phrases (126)
short tempermighty mousegreat schismmary shelleyx chromosomecommon shrewanemone fishfemale chestfemale horseman-on-a-horse
...View all with 11 letters...
Words (910)
accomplishedmanslaughterheadmistressthunderstormmetaphysicalhousewarmingsledgehammerimpoverishedbiochemistryastonishmentschoolmasterhysterectomymalnourishedspeechmakingsouthernmosthomesicknessmerchandisernorthernmostmonotheisticmisbehaviourgamesmanshipchrestomathyhomelessnessenglishwomanhaemorrhoidslongshoremansalesmanshiperythematoussummerhousesalmightinesshorsemanshiphandsomenessundiminishedpsychometricdehumanising
...View all with 12 letters...
Phrases (188)
elihu thomsongenus anethummrs. henry woodmount shermanprotest marchgenus mahoniamissel thrushgenus chamaeabenjamin rushhome invasion
...View all with 12 letters...
Words (775)
establishmentmassachusettshomosexualitycomprehensioncomprehensivemetamorphosismerchandisingchrysanthemummagnetospherechristmastimeshamelessnessantihistamineunsympatheticexhibitionismrefurbishmentembellishmentsympathectomymetamorphosesthermoplasticphysostigminetransshipmentreplenishmentthermosettinghaematologistloathsomenesswholesomenessdexamethasoneblandishmentsseismographicleishmaniasispharmaceuticsmischievouslystatesmanshipmorphogenesissqueamishness
...View all with 13 letters...
Phrases (232)
john masefieldhard-shell clammount rushmoremount st. helensgenus anthemismachine stitchchristmas cakestealth bomberos scaphoideumbritish empire
...View all with 13 letters...
Words (624)
accomplishmentcomprehensiblethermodynamicschemosynthesismetaphysicallymetempsychosismicrochemistryrelinquishmentschoolmistressunaccomplishedmephistophelesdisenchantmentimpoverishmentheadmastershipmechanicalnessplethysmographelectrochemistdemythologisedoveremphasizedchemosyntheticservomechanismmalnourishmenthippopotamusesomphaloskepsisshamefacednessaccomplishablemonosaccharidepachydermatousdisheartenmentmethodicalnessholometabolismcomprehensiblycomprehensionschromaticitiesdisfurnishment
...View all with 14 letters...
Phrases (250)
theodor mommsenischemic strokefisherman's lurechristmas bellsgenus chamaeleomale chauvinistrobert schumannachromatic lensgenus mammuthusphleum pratense
...View all with 14 letters...
Words (424)
misapprehensionsympathomimeticenfranchisementstereochemistrycholecystectomyplainclothesmanmischievousnesssympatheticallyincomprehensioneuphemisticallycomprehensivelyincomprehensiveimperishabilityhermaphroditismblameworthinesswarmheartednesshomogeneousnessblasphemousnessaccomplishmentsreestablishmentechinodermatousinhomogeneitiesschoolmasterishmetallographiesthyroidectomiesnonachievementsdehumanizationsschematizationsoverhomogenizesanthropometriesposthemorrhagicunderemphasizedunderemphasizesepitheliomatousmethylxanthines
...View all with 15 letters...
Phrases (297)
helen wills moodydialysis machinemrs. humphrey wardgenus gnaphaliumacheta assimilisacheta domesticasystem of weightsstuffed mushroomsodium hydroxidehyoscyamus niger
...View all with 15 letters...
Words (174)
incomprehensibleincomprehensiblyundernourishmentsphygmomanometerthermostaticallyepiphenomenalismelectrochemistryanthropomorphisenorthamptonshirethermolabilitiesmiscomprehensionradiochemistriesspectroheliogramuncomprehensibleextrachromosomalthermoperiodismscommissionershiphypersomnolencesthermoplasticityhyperstimulatingheterometabolismnoncomprehensivehyperstimulationheterometabolousthermoregulatorsmachiavellianismparasympatheticsthermoremanenceshyperthyroidismshypervitaminosessphygmomanometrythromboembolismsarchaeoastronomyhypophysectomiesposthumousnesses
...View all with 16 letters...
Phrases (309)
manihot esculentadelphinium ajacisw. somerset maughamstephane mallarmesermon on the mountchemical analysismephitis macrouragenus chaenomelesrubus chamaemorussodium thiopental
...View all with 16 letters...
Words (88)
chemiluminescencecomprehensivenessnonmathematiciansmiscomprehensionsthermoluminescentspectroheliogramsparaformaldehydescommissionershipsdisestablishmentshyperstimulationsthermoregulationsdisfranchisementsspectrophotometrythermostabilitiessphygmomanometersthrombocytopeniashypophysectomizeshypophysectomisedhypophysectomizedencephalomyelitisstereochemistriesmachine-accessiblelymphadenopathiescyclophosphamidesimmunochemistriespharmacotherapiesbathythermographswarmheartednessesimmunopathologiesphenylethylaminesopenmouthednessespheochromocytomasdehumidificationsbiogeochemistriesbiomathematicians
...View all with 17 letters...
Phrases (302)
heat of sublimationgopherus polypemusjohn moses browningpast-tense morphemehashimoto's diseasearchibald macleishgenus symphalangustheological systemprimary censorshipline of merchandise
...View all with 17 letters...
Words (69)
spectrophotometrichyperaldosteronismdisenfranchisementthermoluminescencemethyltestosteronepolymorphonuclearsthermoplasticitiesspectrophotometersnoncomprehensivelyinharmoniousnessesmonochromaticitiessphygmomanometriesarchaeoastronomiesthrombophlebitideshypophysectomizingrechromatographiesmuddleheadednessescomprehensiblenesslymphangiographiesstoichiometricallypteridospermaphytamacrophotographiesmucopolysaccharideimmunohematologiesimmunohematologisthypercholesteremiasaccharomycetaceaeplasmodiophoraceaeelectrochemistriesmechanochemistriesimperishablenessesphosphoglucomutaseaerothermodynamicselectromyographiesdemythologizations
...View all with 18 letters...
Phrases (330)
washington monumentgenus struthiomimusphotographer's modelfamily physeteridaedame sybil thorndikelachrymal secretionmount rushmore statemoschus moschiferusclass schizomycetessir martin frobisher
...View all with 18 letters...
Words (51)
hyperparathyroidismpseudohermaphroditethermoluminescencesdisenfranchisementsthermoperiodicitiesspectrophotometriesparathyroidectomiesencephalomeningitismucopolysaccharidescomprehensibilitiescomprehensivenessesanarcho-collectivismimmunocytochemistryimmunohematologistsimmunohistochemicalphenomenalisticallyneuropharmacologiesneuropharmacologistphosphoglucomutasesphosphomonoesterasethird-dimensionalityhysterosalpingogramthree-dimensionalityphotodecompositionsmeningoencephalitiselectrophoretogramsmethylcholanthreneshemidemisemiquaversmethylprednisolonesmakataimeshekiakiakincomprehensibilityencephalomyelitidesdihydrostreptomycinhydrometeorologistschromolithographers
...View all with 19 letters...
Phrases (251)
robert emmet sherwoodjohn millington syngeallium schoenoprasumgenus symphoricarposbattle of saint-mihielstephen michael reichchinese monetary unitbattle of the metaurussymphytum officinaletransmission channel
...View all with 19 letters...
Words (31)
hypercholesterolemiasemiautobiographicalradiopharmaceuticalsspectrophotometricalhyperadrenocorticismcomprehensiblenesseslymphogranulomatosesphenylpropanolaminesphenylthiocarbamidespseudohermaphroditicoophorosalpingectomyglomerulonephritidesneuropharmacologistsphosphomonoesterasesmagnetohydrodynamicsimmunohistochemistryincomprehensiblenessmicroelectrophoresesmicroelectrophoresishistocompatibilitiesencephalomyocarditisantiestablishmentismchlorofluoromethanespseudoparenchymatouspsychopharmacologieshypercholesterolemicdimethylnitrosaminesheterobasidiomycetesplethysmographicallyhyperparathyroidismsmischaracterizationsPhrases (206)
archeological remainswyethia amplexicaulisabelmoschus moschatusphotographic emulsionsecond coming of christwalther hermann nernstsphenisciform seabirdislamic calendar monthgeorges henri lemaitrepoor man's weatherglass
...View all with 20 letters...
Words (10)
disestablishmentarianimmunocytochemistriesimmunoelectrophoresesestablishmentarianismpseudohermaphroditismelectroencephalogramsmeningoencephalitidesimmunoelectrophoresisincomprehensibilitieshypercholesterolemiasPhrases (203)
acrocentric chromosomesir john everett millaisabelmoschus esculentusadministrative hearinghelianthemum scopariumanaphalis margaritaceaanthriscus cereifoliumhelichrysum bracteatumanigozanthus manglesiistephen william hawking
...View all with 21 letters...
Words (10)
disestablishmentariansspectrophotometricallyimmunohistochemistriesintercomprehensibilitycarboxymethylcelluloseincomprehensiblenessesencephalomyocarditisesestablishmentarianismsmicrospectrophotometermicrospectrophotometryPhrases (155)
schlumbergera truncatusleishmaniasis americanaherbert marshall mcluhaninstrument of punishmentsodium tripolyphosphatebattle of the bismarck searhythm and blues musicianathyrium thelypteroidescapital of massachusettsmusculus triceps brachii
...View all with 22 letters...
Words (4)
carboxymethylcelluloseshexamethylenetetraminesmicrospectrophotometersmicrospectrophotometricPhrases (110)
family threskiornithidaetransient ischemic attacktribasic sodium phosphateaugust wilhelm von hofmannkazakhstani monetary unitthiopentobarbital sodiumhenri emile benoit matissebangladeshi monetary unitsouth korean monetary unitgroup pteridospermaphyta
...View all with 23 letters...
Words (5)
intercomprehensibilitiesphosphatidylethanolaminedichlorodifluoromethanesmicrospectrophotometriesschizosaccharomycetaceaePhrases (95)
basque homeland and freedompelham grenville wodehouseargyroxiphium sandwicensesubphylum cephalochordataprimary sex characteristicbattle of the spanish armadaarthur meier schlesinger jr.commonwealth of the bahamasrichard buckminster fullertechnology administration
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesantiestablishmentarianismPhrases (69)
embryonal rhabdomyosarcomamary wollstonecraft shelleybattle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentdistinguished service medalfriedrich wilhelm nietzschemodest petrovich mussorgskyedmund john millington syngepolystichum acrostichoides
...View all with 25 letters...
Phrases (54)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanbattle of monmouth court housebacon-lettuce-tomato sandwichjames abbott mcneill whistlerhuman immunodeficiency virusemployee stock ownership planandrei dimitrievich sakharovcharles maurice de talleyrandclement philibert leo delibes
...View all with 26 letters...
Phrases (41)
electromechanical transduceraugustus welby northmore puginfreedom from search and seizurejerusalem artichoke sunflowerpull the wool over someone's eyesdeoxyadenosine monophosphatedeoxythymidine monophosphatethyrotropin-releasing hormonehomo sapiens neanderthalensissir frederick william herschel
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (41)
marcus junius brutus the youngerfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycommission on the status of womenfederal housing administrationfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskydepartment of homeland securitysergei mikhailovich eisensteindissident irish republican army
...View all with 28 letters...
Phrases (22)
chemical decomposition reactionfriedrich wilhelm august froebeldmitri dmitrievich shostakovichsao thome e principe monetary unitferdinand joseph la menthe mortonhydrangea macrophylla hortensispresident william henry harrisongeorges joseph christian simenontripleurospermum tchihatchewiifyodor mikhailovich dostoyevsky
...View all with 29 letters...
Phrases (19)
valentina vladmirovna tereshkovaaleksandr mikjailovich prokhorovaugust friedrich leopold weismannwaterhouse-friderichsen syndromeplasma thromboplastin antecedentmucocutaneous lymph node syndromeesther hobart mcquigg slack morrishenri rene albert guy de maupassantdag hjalmar agne carl hammarskjoldalfred charles william harmsworth
...View all with 30 letters...
Phrases (14)
marie louise elisabeth vigee-lebrundigital communications technologysir john frederick william herschelanicius manlius severinus boethiusprimary subtractive color for lightislamic jihad movement in palestinewernher magnus maximilian von brauncommonwealth of independent statesrichard august carl emil erlenmeyerarmenian apostolic orthodox church
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (16)
nikolai andreyevich rimski-korsakovafrican american vernacular englishhierarchical classification systemstraight-line method of depreciationnikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylateprimary subtractive colour for lightedmond louis antoine huot de goncourtoculopharyngeal muscular dystrophylymphocytic choriomeningitis virus
...View all with 32 letters...
Phrases (10)
characteristic root of a square matrixepistle of paul the apostle to philemonbureau of alcohol tobacco and firearmsmusculus sphincter ductus choledochidisease of the neuromuscular junctionmercury-in-glass clinical thermometersecretary of health and human servicespositron emission tomography scannerhimantopus himantopus leucocephalusdefense technical information centerPhrases (10)
jacques francois fromental elie halevychronic obstructive pulmonary diseasefederal islamic republic of the comorosepistle of paul the apostle to the romansinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticimassachusetts institute of technologydepartment of health and human servicesbaron hugh caswall tremenheere dowdingcomputerized axial tomography scannerPhrases (8)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanuelsocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weber