Words Containing: S,E,I,S,E,S
(In Any Order)
There are 5,027 words,
1,569 phrases and
0 abbr's with
S,E,I,S,E,S in.
Best Scoring Words With: S,E,I,S,E,S
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| speises | 7 | 9 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| semises | 7 | 9 | ||||||
Valid word for Scrabble US
| ||||||||
| sessile | 7 | 7 | adjectiveadj | |||||
adjective • permanently attached to a substrate; not free to move about • attached directly by the base; not having an intervening stalk | ||||||||
| senseis | 7 | 7 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| seisers | 7 | 7 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| seises | 6 | 6 | ||||||
verb • To vest ownership of a freehold estate in (someone). • (with of) To put in possession. • To seize. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
seisesWords (37)
sexinesseasinessmessiestwisenessesthesisseisuresdiseasesfinessessemiosesreissuesseasidesmissensebekissesfesswisespeissesmiseasesenosisespelissesmetissessiamesesislelessnoesisesdisseisedespiseshessitesidlessessestinesdiseusesecesisesgneissesvitessespressiesivressesassiegesesquisse
...View all with 8 letters...
Words (113)
obsessivepriestessspinelessmessieurssecessionisoscelesnoiselessseedinesstestinessmessinesssensiblesdressiestwitnessesassigneesselenosisdispersesspicelesssightseeshipnessesresistersingressesillnessesecstasiesskepsisespeskinessheiresseseisegesislionessesdisseverssidednesssidedressicinessesmissensessubseriessideroses
...View all with 9 letters...
Words (348)
distressedpossessivestepsistersuccessiveemissariesuneasinesssleepinesssubspeciesjewishnesspressurisesinglenesssneakinesssynthesisesteadinessqueasinessresistlesssmearinesssobersidesdesirelesssuspensivegreasinesssimplenesssynaeresissteaminessspeedinessreservistsmesmerisespersistersbrasseriesstrifelesspokinessesholinessesassemblieslimpnessesshoeshines
...View all with 10 letters...
Phrases (5)
skin sensesbest wishesgenus ensisramesses iisixth senseWords (728)
businessmenseriousnessselfishnessdisassembleobsessivelysynesthesiaseasicknessspecialnessdesensitisesubsistencenecessariesnoiselesslytediousnesswinsomenessfestivenesssilversidesheinousnessabusivenesssightednesshideousnesssuppressivemiserlinessevasivenessdeviousnessbeastlinesssynthesisersystematiseimmensenessnoisomenesshirsutenesssinlessnesslissomenessnecessitousconcisenessrestiveness
...View all with 11 letters...
Phrases (10)
visual senseskin diseasefish speciesbessie smithemesis basinswiss cheesegenus seseliswiss peopledress whitesgenus stelisWords (800)
headmistressrepossessiondispossessedhomesicknesslovesicknessbusinesslikedecisivenesslistlessnessabrasivenesstimelessnessecclesiastespreciousnessmindlessnessspitefulnessintersessionsuccessivelydivisivenessunsteadinessdepressurisespeciousnesspseudocyesissupersessionlifelessnessquestionlessunseemlinessshrewishnesscohesivenessosteogenesisshirtsleevessynaesthesiadevilishnesssheepishnessthievishnesseffusivenessstealthiness
...View all with 12 letters...
Phrases (29)
business lifebusiness lineaegates islesbang's diseasegenus melissapick's diseasecelsius scalebusiness dealfield glassesgenus isoetes
...View all with 12 letters...
Words (796)
righteousnessassertivenessexpressionismoffensivenessexclusivenessseductivenessimpetuousnesssecretivenesstransgressivebusinesswomenexpressionistexcessivenessimpulsivenessinclusivenesslimitlessnessexpansivenessdefensivenessfaithlessnessspinelessnesssensitivenessobsessivenessrepulsivenesspointlessnessdeliciousnesstenaciousnessingenuousnessreligiousnessprepossessingexplosivenessunselfishnessferociousnesssqueamishnessdissolutenessdesirablenessingeniousness
...View all with 13 letters...
Phrases (73)
white asbestosbusiness indexcupid's diseasepaget's diseasesailing vesselbeardless irisgenus lebistesosseous tissueinside passagegenus agdestis
...View all with 13 letters...
Words (729)
aggressivenesspermissivenesschemosynthesisweightlessnessrebelliousnesslicentiousnessmetempsychosisbusinesspersonexpressivenessexpressionlesspossessivenessmesdemoisellesresponsivenesspersuasivenessunbusinesslikeoppressivenessmotionlessnesscompulsivenessrepressivenesshospitablenessfarsightednessbusinesspeopleobsequiousnessprecariousnessmysteriousnessgregariousnessmeticulousnessindecisivenesssupersensitivecoquettishnessnewsworthinessgelatinousnessperfidiousnessimperviousnessoleaginousness
...View all with 14 letters...
Phrases (71)
kissing diseasebusiness letterbusiness officeline of businessbusiness peoplebabies' slipperstaste sensationgenus sciaenopsgenus eptesicusoyster dressing
...View all with 14 letters...
Words (663)
spermatogenesisdestructivenessmeaninglessnesspretentiousnessforesightednessinquisitivenessexpressionisticacquisitivenessinexpensivenessstereoisomerismdistinctivenessunrighteousnessmischievousnessnearsightednessatherosclerosisunprepossessingsymmetricalnessdistastefulnesstightfistednessprestigiousnessprogressivenessresponsiblenessserviceablenessemotionlessnessdisgracefulnessmeritoriousnessprecipitousnesssusceptiblenesscontentiousnessperspicuousnessrestrictivenessconsideratenessimpecuniousnessexpeditiousnesssuppressiveness
...View all with 15 letters...
Phrases (112)
felis domesticusbusiness expensepieris brassicaequarter sessionssystem of weightsorder of businesssales resistancebleeder's diseasesnake in the grassshel silverstein
...View all with 15 letters...
Words (334)
anesthesiologistshortsightednessostentatiousnessabsentmindednessarteriosclerosisdisconnectednesspolydispersitiescolorblindnessesdiscursivenessesdisdainfulnessesambidextrousnessinfectiousnessesunmannerlinessesinflexiblenessespraiseworthinessingloriousnessesingressivenessescommodiousnessesfactitiousnessespossessivenessesinimitablenessesfallaciousnessesiniquitousnessesdisconsolatenesshyperviscositiesinnovativenessesthriftlessnesseslasciviousnessesdiscontentednessdisjointednessesfarsightednessesinordinatenessesspiritlessnessescreaturelinessesdisorderednesses
...View all with 16 letters...
Phrases (100)
business relationchristmas diseaseline of successionascension of jesuschristmas presentmechanical stressdisease of the skinenglish professorpersonal businessgenus dendroaspis
...View all with 16 letters...
Words (224)
immunosuppressiveconscientiousnesscomprehensivenessdisinterestednessirrevocablenessesmiscomprehensionsparadoxicalnessesinflammablenessesunmelodiousnessesunmitigatednessesinformativenessesunobtrusivenessesserious-mindednesskindheartednessesdisestablishmentsdisfranchisementsinheritablenessesdisgracefulnessesmistrustfulnessesinjudiciousnessesinoffensivenessesfantasticalnessesinoperativenessescrashworthinessesinopportunenessesappropriatenessescomparativenessesinquisitivenessessemiconsciousnessfashionablenessessplendiferousnessinscrutablenessesunrighteousnessesinsensitivenessestightfistednesses
...View all with 17 letters...
Phrases (146)
hashimoto's diseasespecial assessmenterithacus svecicuslepisosteus osseuspetasites hybridusgenus phalaenopsisanemone sylvestrisgenus broussonetiaundescended testisnervus accessorius
...View all with 17 letters...
Words (123)
inexpugnablenesseshypersensitivenesshypersensitivitiescounterstrategistscountersuggestionsspectrohelioscopesinharmoniousnessesmisrepresentationsradiosensitivitiesinhospitablenessesdishonorablenessesfaintheartednesseslandlubberlinessesunprinciplednessescommunicablenessesrambunctiousnessesdisingenuousnessesunprofitablenessesarteriolosclerosisappreciativenessesapprehensivenessesunresponsivenessescreditworthinessesunrestrainednessesfeeblemindednesseslightheartednessesdisputatiousnessesdisreputablenessestranscendentalismscomprehensiblenesstranscendentalistscurmudgeonlinessesimmeasurablenessespraiseworthinessesvaingloriousnesses
...View all with 18 letters...
Phrases (134)
business enterpriseclass schizomycetesinterstitial tissuegenus chamaecytisusmaterial possessionorder passeriformesrespiratory illnessunfinished businessgenus eschscholtziamorchella crassipes
...View all with 18 letters...
Words (72)
disenfranchisementshypersensitizationsextraordinarinessesunpretentiousnessesnonproductivenessessurface-assimilativecommunicativenessesdisinterestednessescompanionablenessessplendiferousnessesdispassionatenessesunconscientiousnesscompassionatenessesinstantaneousnessescomplementarinessesdisrespectabilitiescomprehensivenessesdisrespectfulnessesstereospecificitiesauthoritativenessesperspicaciousnessesobjectionablenessesmultitudinousnessesconscientiousnessesconsequentialnessesgastroenterologistsaccommodativenessesprefigurativenessesgentlemanlikenessesneurofibromatosisescontemplativenessesreprehensiblenessescontradictorinessesobsessive-compulsiveimpressionabilities
...View all with 19 letters...
Phrases (109)
cease and desist ordermeat-packing businesshelianthus tuberosusscomberomorus sierrauniverse of discoursegreater sunda islandscost-benefit analysisworcestershire saucesuperoxide dismutasebearing false witness
...View all with 19 letters...
Words (29)
unintelligiblenesseshypersensitivenessesunrepresentativenessunsatisfactorinessescomprehensiblenessesinterconnectednessesrepresentationalismsrepresentationalistsrepresentativenessesinappreciativenesseselectrophysiologistsultrasegregationistsincomprehensiblenessinconsiderablenessespseudocholinesterasesuperspecializationsantiestablishmentismphotoreconnaissancesuncompromisingnessesunconscionablenessesindestructiblenessesnondestructivenessesindiscriminatenessesoverprotectivenessesnephroangiosclerosishyperconsciousnessesirreconcilablenessesirreproachablenessesexpressionlessnessesPhrases (92)
suborder strepsirhinipast progressive tensebusiness relationshipambloplites rupestrisrobert louis stevensonstephen collins fosterbalance sheet analysisscomberomorus regalissphenisciform seabirdjudgement of dismissal
...View all with 20 letters...
Words (11)
disestablishmentarianhypersusceptibilitiesstraightforwardnessesestablishmentarianisminterchangeablenessesacetylcholinesterasespseudocholinesterasesundemonstrativenessesindistinguishablenessunexceptionablenessesdisadvantageousnessesPhrases (94)
use of goods and servicesgasterosteus pungitiusaleksandr solzhenitsynbattle of soissons-reimsfrancisella tularensissecond sino-japanese warpseudemys rubriventrisphascolarctos cinereusimmune suppressant drugstream of consciousness
...View all with 21 letters...
Words (6)
disestablishmentariansunrepresentativenessesimmunohistochemistriesphiloprogenitivenessesincomprehensiblenessesestablishmentarianismsPhrases (78)
coronavirus disease 2019leishmaniasis americanaaleksandr i. solzhenitsynfuture progressive tenseguided missile destroyersternocleido mastoideusacipenser transmontanusgoing-out-of-business saleengraulis encrasicholusscentless false camomile
...View all with 22 letters...
Words (3)
nonrepresentationalismsintersubstitutabilitiesindistinguishablenessesPhrases (64)
to all intents and purposesboeing b-52 stratofortressparis-sorbonne universityhippoglossus stenolepsisclassified advertisementcervus elaphus canadensisepinephelus adscensionissearch and destroy missionpedioecetes phasianellustarget acquisition system
...View all with 23 letters...
Phrases (64)
brassica oleracea botrytiscucumis melo cantalupensisexistentialist philosophyequus caballus przewalskiicharles augustus lindberghcharles camille saint-saenssir charles william siemensdesensitisation procedurejean louis rodolphe agassizesme stuart lennox robinson
...View all with 24 letters...
Words (1)
antiestablishmentarianismPhrases (68)
united states secret servicebureau of justice assistancebureau of justice statisticsmusculus quadriceps femorisdistinguished service medalmodest petrovich mussorgskywar of the spanish successiondistribution free statisticsternocleidomastoid musclereligious society of friends
...View all with 25 letters...
Phrases (42)
brassica oleracea gongylodeswar of the austrian successionmalignant neoplastic diseasesecretary of veterans affairsherpes varicella zoster virussir charles scott sherringtontrespass quare clausum fregitparthenocissus quinquefoliaatherinopsis californiensisgreat seal of the united states
...View all with 26 letters...
Phrases (36)
business environment analysisaleksandr sergeyevich pushkinsolenostemon scutellarioidessocial development commissionjames augustine aloysius joycepositive reinforcing stimuluscryptobranchus alleganiensishomo sapiens neanderthalensisinformation processing systemphilippus aureolus paracelsus
...View all with 27 letters...
Phrases (41)
interstate commerce commissionbusiness process reengineeringephippiorhynchus senegalensismarcus junius brutus the youngermicrosoft disk operating systemcommission on the status of womenmaster of arts in library sciencesergei mikhailovich eisensteindissident irish republican armyadministrative data processing
...View all with 28 letters...
Phrases (34)
business environmental analysisbusiness interruption insuranceantisocial personality disordernational volunteers associationautomatic data processing systemmiddle east respiratory syndromedisseminated multiple sclerosisconstitution of the united statesultrasonic pulse velocity testersecond epistle to the corinthians
...View all with 29 letters...
Phrases (24)
battle of spotsylvania court housebattle of spotsylvania courthousemusculus sternocleidomastoideusalexander isayevich solzhenitsynobsessive-compulsive personalityvicomte ferdinand marie de lessepswaterhouse-friderichsen syndromesevere acute respiratory syndromeesther hobart mcquigg slack morrisdryopteris thelypteris pubescens
...View all with 30 letters...
Phrases (21)
united states public health servicesecond epistle to the thessalonians2019-ncov acute respiratory diseaseunited states department of defenseunited states trade representativeanicius manlius severinus boethiusislamic great eastern raiders-frontlanius ludovicianus excubitoridesseptobasidium pseudopedicellatumfederal communications commission
...View all with 31 letters...
Phrases (14)
people against gangsterism and drugshierarchical classification systemsergei aleksandrovich koussevitzkyintercontinental ballistic missilecercopithecus aethiops pygerythrusisidore auguste marie francois comtemarcus aurelius valerius maximianusketosis-resistant diabetes mellitusinsulin-dependent diabetes mellitustyrannus domenicensis domenicensis
...View all with 32 letters...
Phrases (16)
autonomous sensory meridian responselycopersicon esculentum cerasiformemusculus obliquus externus abdominiselizabeth cleghorn stevenson gaskellmusculus sphincter ductus choledochilaser-assisted in situ keratomileusissir winston leonard spenser churchillkonstantin sergeyevich stanislavskydisease of the neuromuscular junctionfloating-point representation system
...View all with 33 letters...
Phrases (15)
relational database management systemchronic obstructive pulmonary diseaseacademy of television arts and sciencesepistle of paul the apostle to the romansgeorge louis palmella busson du mauriernero claudius caesar drusus germanicusmusculus sphincter ductus pancreaticivena centralis glandulae suprarenalisdryopithecus rudapithecus hungaricusclostridium perfringens epsilon toxin
...View all with 34 letters...
Phrases (13)
communications security establishmentunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkocomte donatien alphonse francois de sadenational socialist german workers' partychristopher william bradshaw isherwoodquintus septimius florens tertullianustransurethral resection of the prostateballistic missile defense organizationnon-insulin-dependent diabetes mellitus
...View all with 35 letters...
Phrases (11)
severe combined immunodeficiency diseasesisters of the order of saint basil the greatfirst epistle of paul the apostle to timothyketoacidosis-resistant diabetes mellitusdemocratic socialist republic of sri lankaacademy of motion picture arts and sciencesepistle of paul the apostle to the ephesiansepistle of paul the apostle to the galatianscongregation of the sisters of saint hedwigsixteen personality factor questionnaire
...View all with 37 letters...
