Words Containing: S,A,R,K,I,N,G
(In Any Order)
There are 213 words,
320 phrases and
0 abbr's with
S,A,R,K,I,N,G in.
Best Scoring Words With: S,A,R,K,I,N,G
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
skylarking | 10 | 22 | verb, nounv, n | |||||
noun • brown-speckled European lark noted for singing while hovering at a great height verb • play boisterously | ||||||||
kingmakers | 10 | 21 | nounn | |||||
noun • an important person who can bring leaders to power through the exercise of political influence • English statesman; during the War of the Roses he fought first for the house of York and secured the throne for Edward IV and then changed sides to fight for the house of Lancaster and secured the throne for Henry VI (1428-1471) | ||||||||
phreakings | 10 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
kurbashing | 10 | 20 | nounn | |||||
Valid word for Scrabble US
| ||||||||
kingcrafts | 10 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
cracklings | 10 | 19 | nounn | |||||
noun • the crisp residue left after lard has been rendered | ||||||||
mismarking | 10 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
shrinkages | 10 | 18 | nounn | |||||
noun • process or result of becoming less or smaller • the amount by which something shrinks • the act of stealing goods that are on display in a store | ||||||||
hankerings | 10 | 18 | nounn | |||||
noun • a yearning for something or to do something | ||||||||
shikarring | 10 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (31)
ransackingshrinkagescracklingshankeringsrestackingpresoakingkingmakersmarketingsstreakingsrespeakingskylarkinggrimalkinsphreakingsshikarringmismarkingkurbashingkingcraftsparaskiingdisparkingdisrankingkreasotingstarkeningninkharsagninkhursagdisbarkingvraickingsspracklingsparklingskirgizstanpartakingsforsakingsPhrases (5)
skiing raceking's spearsailor kingtiger snakesmoking carWords (36)
dressmakingringstrakedpostmarkinggrubstakingwaterskiingcaretakingsstringybarkcarjackingsovertaskingrainmakingsasteriskingoversoakingforspeakingwater-skiingskrimmagingbracketingsparaskiingsranshaklingkourbashingagkistrodonfingermarkskyrgyzstaniskylarkingsmuckrakingsgrayish-pinkkarstifyingsalt-workingmoonrakingssparklinglykirghizstanawestrikingparakitingsforslackingbestreakingbarrackings
...View all with 11 letters...
Phrases (12)
genus krigiaasking pricespring breakracing skateracing skiffskating rinkreading deskgenus kirkiaking's ransomfinger lakes
...View all with 11 letters...
Words (52)
earthshakingdisembarkingoutsparklingsidetrackinglawbreakingsphrasemakingundertakingsmerrymakingsbricklayingswisecrackingbreakfastingwaterskiingsstringybarksdressmakingsprintmakingsgreenbackismsafecrackingforespeakingbackcrossingtracklayingskickstartingpapermakingsracewalkingsnightwalkerspawnbrokingsthanksgiverskeyboardingsrankshiftingmarlingspiketraffickingsreawakeningsranshacklingbackspeeringbackspeiringaerobrakings
...View all with 12 letters...
Phrases (14)
genus makairatoasting forkmasking paperdressing sackpine grosbeaksoaking syrupfor the askingkey signatureparking spacesparking plug
...View all with 12 letters...
Words (29)
skateboardingstreetwalkinghousebreakingmetalworkingskindergartenswakeboardingsbenchmarkingsgreenbackismsphrasemakingssafecrackingssparkpluggingracketeeringsskrimshankingfrankalmoignsblackbirdingsmarlingspikesstalking-horsepremarketingsshopbreakingsbacktrackingsscrimshankingpinkish-orangemuckspreadingbarnsbreakingbreakdancingsmanrikigusarisoundtrackingfarnarkelingsdeerstalkingsPhrases (25)
drinking glasssurgical kniferoller skatingthree kings' dayrayon stockingskirting boardmarketing costmigrant shrikewinning streakgenus pereskia
...View all with 13 letters...
Words (21)
housebreakingstroublemakingsbackscatteringearthshakinglystrikebreakingskateboardingsstreetwalkingstelemarketingskindergartnershydrocrackingsbackscratchingblackberryingsturkic-speakingmicrocrackingsgerman-speakingbarnsbreakingsmallemarokingsmanrikigusarisfrench-speakingkinematographsprison-breakingPhrases (19)
igor stravinskyinsignia of rankmeasuring stickport jackson figgenus brickeliaman-eating sharkalaska king crabgenus manilkaravirginian stockgerman tamarisk
...View all with 14 letters...
Words (9)
straitjacketingbackscatteringsstrikebreakingskindergartenersmicromarketingsbackscratchingsgroundbreakingsrussian-speakingneuromarketingsPhrases (29)
snake in the grasstragulus kanchilturkish languagehorseback ridingsteering linkagegenus rickettsiacassin's kingbirdbackground noisespeaking trumpetgenus suksdorfia
...View all with 15 letters...
Phrases (11)
cosmic microwave backgroundigor fyodorovich stravinskyfrancis scott key fitzgeraldcharles frederick menningercosmic background radiationpodkamennaya tunguska riverangus frank johnstone wilsonsecond marquis of rockinghamvirgin islands national parkvon recklinghausen's disease
...View all with 25 letters...
Phrases (10)
nikita sergeyevich khrushchevaleksandr sergeyevich pushkintaras grigoryevich shevchenkogeorgi konstantinovich zhukovwrangell-st. elias national parkjohannes evangelista purkinjepleuropneumonialike organismmartin luther king jr's birthdaymaurice hugh frederick wilkinssclerosing leukoencephalitisPhrases (1)
grigori aleksandrovich potemkinPhrases (1)
guadalupe mountains national parkPhrases (1)
great smoky mountains national parkPhrases (1)
jakob ludwig felix mendelssohn-bartholdy