Words Containing: R,S,K,Y
(In Any Order)
There are 468 words,
475 phrases and
0 abbr's with
R,S,K,Y in.
Best Scoring Words With: R,S,K,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
byworks | 7 | 19 | ||||||
Valid word for Scrabble US
| ||||||||
skylark | 7 | 18 | verb, nounv, n | |||||
noun • brown-speckled European lark noted for singing while hovering at a great height verb • play boisterously | ||||||||
skyward | 7 | 18 | adverbadv | |||||
adverb • toward the sky adjective satellite • directed toward heaven or the sky | ||||||||
droshky | 7 | 18 | nounn | |||||
noun • an open horse-drawn carriage with four wheels; formerly used in Poland and Russia | ||||||||
yakkers | 7 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
shrieky | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
skysurf | 7 | 17 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
valkyrs | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
frisky | 6 | 16 | adjectiveadj | |||||
adjective satellite • playful like a lively kitten | ||||||||
sparkly | 7 | 16 | adjectiveadj | |||||
adjective satellite • marked by high spirits or excitement • having brief brilliant points or flashes of light | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (56)
busyworkklystronkerenskyskydiversikorskyrakishlymusketryskywardswhiskeryfriskilysmirkilyhayforkshayricksbasketrysnarkilykeycardsspookerykoupreyskeystersparkwayskayakerskeywordsskyboardskyborneworkdaysturnkeysdayworksskylarkssynkaryasnickeryhydroskiskysurfskryptonsskywriteskywrote
...View all with 8 letters...
Phrases (2)
easy markscrew keyWords (88)
yorkshirestorybookskyrockettarkovskyyardstickkeystrokestockyardskywriterkeynotersbackstoryskydiverssyruplikeskylarkerirksomelywalkyriesskysurfedskysurferteriyakistrackwaysberserklyrockabyesyardworksdockyardsyarmelkesyarmulkeskaleyardskeyboardsstreakilymalarkeysdaybreaksyearbooksskyboardsklystronskymogramsskybridge
...View all with 9 letters...
Phrases (10)
dry socketkey strokestrike paygrey skatelyre snakegray skatework studymaster keyrye whiskysky burialWords (92)
skyscraperrecklesslystravinskyfreakishlystrikinglyskywritingtrotskyiteankylosaurgraywackestrickishlyprankishlykeystrokedcocksurelyskylarkerscarrybacksskyrocketsjackasserymythmakersbrickyardsyardsticksplaymakershyperlinkskeystrokeskymographsskybridgesskyjackersdayworkersskylarkingjayhawkersjaywalkerssynkaryonsskysurfersskysurfingstockyardscyberpunks
...View all with 10 letters...
Phrases (17)
pastry cookforty winksplay tricksoyster bankturkey stewoyster parkalkyd resinstroke playkhyber passcorn whisky
...View all with 10 letters...
Words (69)
baryshnikovskulduggerypersnicketykeyboardistyastrzemskikeystrokingskyrocketedskyscrapersprokaryotesbricklayerskaryogamiesdonnybrooksmoneymakerskeypunchersbradykininsrekeyboardsstringybarkbrainsicklylickerishlyskywritingsankylosaursmerrymakerstracklayerskerseymereskaryologieskaryolymphsdonkeyworkshydrocrackskeyboarderscomstockerypyknometersyamoussukroskuldudderykabaragoyashoneysucker
...View all with 11 letters...
Phrases (25)
mackerel skydirty trickscelery stickleon trotskymaksim gorkywhiskey sourthorny skatebrass monkeyirish whiskydyer's rocket
...View all with 11 letters...
Words (40)
skullduggeryankylosaurushyperkineseshyperkinesiamerrymakingsbricklayingskeyboardistshyperkinesishypermarketsstringybarkskymographiesskyrocketingjourneyworkstracklayingskaryokineseskaryokinesiskeratoplastykeyboardingsyamoussoukrobradykinesiahoneysuckerskeystrokingsblackish-grayblackish-greystravinskyangreyish-blackkeratophyresstockjobberyfernyticklesgrayish-blacksparkleberrydusky-coloredmarrowskyingskinny-dipperkakistocracy
...View all with 12 letters...
Phrases (31)
jockey shortsrisky ventureboris spasskyrhesus monkeyalfred kinseyigor sikorskydenmark veseyswamp hickorysoaking syrupturk's cap-lily
...View all with 12 letters...
Words (14)
holidaymakershyperkinesiasheterokaryonshydrocrackersunshrinkinglybradykinesiasfairnyticklescryoplanktonshydrokineticsdusky-colouredkinesitherapykeratomycosispsychometrikashockumentaryPhrases (32)
el iskandriyahrobert m. yerkesthree kings' daydiospyros kakivan wyck brooksrayon stockingsilky wisteriaryukyu islandstank destroyertreasury stock
...View all with 13 letters...
Words (14)
leukodystrophyphytoplanktersankylosauruseshyperkeratoseshyperkeratosisearthshakinglyheterokaryosesheterokaryosiscantankerouslymegakaryocyteshydrocrackingsblackberryingsyekaterinoslavrimsky-korsakovPhrases (36)
igor stravinskyblackberry bushturkey stuffingdynamic speakerkeynote addressstrawberry marksouth yorkshirehenry kissingercyrus mccormickbishop berkeley
...View all with 14 letters...
Words (5)
leukodystrophiesphenylketonuriasphenylketonuricsdniprodzerzhynskheterokaryosisesPhrases (35)
strictly speakingcock-and-bull storyfyodor dostoevskifyodor dostoevskyelwyn brooks whitefeodor dostoevskyassyrian akkadiantrackless trolleycoral honeysucklepresident kennedy
...View all with 16 letters...
Phrases (12)
igor fyodorovich stravinskyfrancis scott key fitzgeraldmodest petrovich mussorgskytrans-alaska pipeline systemandrei arsenevich tarkovskypodkamennaya tunguska riverchamaecyparis nootkatensisfederal home loan bank systemhenry kenneth alfred russellcommunist party of kampuchea
...View all with 25 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay