Words Containing: R,E,P,L,A,Y,E,D
(In Any Order)
There are 113 words,
399 phrases and
0 abbr's with
R,E,P,L,A,Y,E,D in.
Best Scoring Words With: R,E,P,L,A,Y,E,D
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
paraldehyde | 11 | 21 | nounn | |||||
noun • a colorless liquid (a cyclic trimer of acetaldehyde) that is used as a sedative and a solvent | ||||||||
depravedly | 10 | 20 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
overplayed | 10 | 19 | adjectiveadj | |||||
verb • exaggerate one's acting | ||||||||
underplayed | 11 | 18 | adjectiveadj | |||||
verb • act (a role) with great restraint • play a card lower than (a held high card) | ||||||||
clepsydrae | 10 | 18 | nounn | |||||
noun • A water clock, especially as used in the ancient world. | ||||||||
preparedly | 10 | 18 | ||||||
Valid word for Scrabble US
| ||||||||
redisplayed | 11 | 18 | verb, adjectivev, adj | |||||
verb • To display again. | ||||||||
desperately | 11 | 17 | adverb, adjectiveadv, adj | |||||
adverb • with great urgency • in intense despair | ||||||||
interplayed | 11 | 17 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
repeatedly | 10 | 16 | adverbadv | |||||
adverb • repeatedly | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (16)
predominatelyhyperinflateddeprecatinglydeprecatorilyopenheartedlyexasperatedlypredicativelydeprecativelyphylloxeridaepeachy-coloredpterodactylesprickly-leafedprickly-leavedcyclopteridaeradioteletypelycoperdaceaePhrases (7)
dna polymerasepays de la loirelatency periodaldehyde groupbird's-eye maplepenny dreadfulbeaked parsleyWords (20)
departmentallypreponderantlypreponderatelypresidentiallydepreciatinglyhyperpolarizedhyperlipidemiapremeditatedlyradiotelephonyhydrocephaliesaerohydroplaneprecedentiallyhyperpolarisedundecipherablypeachy-colouredperissodactylehyperdactyliesmeanspiritedlyindecipherablyradioteletypesPhrases (11)
polymeric amiderecorder playerliterary periodpudendal arteryalpine lady fernfamily pieridaepedal extremitylady of pleasurebay-leaved caperdouble jeopardy
...View all with 14 letters...
Words (20)
perpendicularlyhyperstimulatedreduplicativelyhyperlipidemiasradiotelegraphydephosphorylatehydrocephaluseshyperventilateddecipherabilityhyperadrenalismpropionaldehydepterodactylidaedactylopteridaeaerohydroplaneshyperlipidaemiahyperlipoidemiahydrophyllaceaebutterfly-shapedperissodactylespaleodendrologyPhrases (16)
family leporidaeslender lady palmcollared peccarypresident taylorspecial deliverypolyhedral angledry plate processfamily proteidaefamily pteriidaefamily viperidae
...View all with 15 letters...
Words (11)
paraformaldehydeperpendicularitylyginopteridaleshyperlipoidaemiadephosphorylateddephosphorylatesdepolymerizationpalaeodendrologydiacetylmorphinethelypteridaceaelepidobotryaceaePhrases (25)
exemplary damagesorder polygonalesgrand mal epilepsyexternal body partfamily passeridaeorder hypocrealesfamily cypraeidaeswamp candleberryfamily trypetidaecomplementary dna
...View all with 16 letters...
Words (4)
cercidiphyllaceaeparaformaldehydesdisrespectabilitydepolymerizationsPhrases (41)
class rhodophyceaecylinder separatorjoseph deems taylorfamily peramelidaeearly purple orchidreticulated pythonearly spider orchidfamily apterygidaeconcave polyhedronasplenium bradleyi
...View all with 17 letters...
Words (4)
phenylthiocarbamideinterdepartmentallydimethyltryptamineselectrocardiographyPhrases (46)
family cyclopteridaehydrobates pelagicussubfamily perdicidaegerard manley hopkinsfixed-cycle operationdreissena polymorphafamily acipenseridaesuperfamily muroideafamily phalangeridaewilliam sydney porter
...View all with 19 letters...
Words (2)
phenylthiocarbamidesencephalomyocarditisPhrases (40)
family trachipteridaefriendly relationshipamyloid protein plaqueclarence shepard day jr.lateral epicondylitissuperfamily coccoideaorder mycoplasmatalesclustered poppy mallowfamily pleuronectidaephilosophy department
...View all with 20 letters...
Words (2)
phosphoglyceraldehydepolyvinyl-formaldehydePhrases (33)
eucalyptus fraxinoidesprocaine hydrochloridefamily myrmecophagidaepercy aldridge graingersuperfamily tyrannidaeorder lyginopteridalesclustered lady's slipperfamily dactylopteridaecomplementary medicinefamily balaenopteridae
...View all with 21 letters...
Words (3)
phosphoglyceraldehydesencephalomyocarditisesdihydroxyphenylalaninePhrases (37)
redevelopment authorityfamily dendrocolaptidaeathyrium thelypteroidesmale reproductive systemparliamentary proceduredepartment of philosophyfamily phoenicopteridaepearl sydenstricker buckperfectly elastic demandfamily lepidobotryaceae
...View all with 22 letters...
Words (1)
electrocardiographicallyPhrases (13)
privately held corporationfederal republic of germanyperfectly inelastic demandfamily plasmodiophoraceaepiperocaine hydrochloridesuperorder malacopterygiifemale reproductive systemsaccharomyces ellipsoidesdepartment of anthropologytranscendental philosophy
...View all with 24 letters...
Phrases (11)
lepidocybium flavobrunneumcomplementary distributioncladorhyncus leucocephalumsuperorder labyrinthodontapelvic inflammatory diseasefreedom from double jeopardyindented cylinder separatordemocratic-republican partypan troglodytes troglodytescompact disc read-only memory
...View all with 25 letters...
Phrases (10)
holy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkintricyclic antidepressant drugtopical prostaglandin eyedropmetasequoia glyptostrodoidesfederal republic of yugoslaviakennedy international airportlateral humeral epicondylitiscomputerized axial tomographyWords (1)
dichlorodiphenyltrichloroethanePhrases (1)
department of defense laboratory system