Words Containing: R,E,N,I,N
(In Any Order)
There are 8,764 words,
7,431 phrases and
0 abbr's with
R,E,N,I,N in.
Best Scoring Words With: R,E,N,I,N
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| kerning | 7 | 12 | verb, nounv, n | |||||
noun • the part of a metal type that projects beyond its body • United States composer of musical comedies (1885-1945) verb • furnish with a kern • remove a portion of space between (adjacent letters) | ||||||||
| skinner | 7 | 11 | nounn | |||||
noun • United States actor (1858-1942) • a person who prepares or deals in animal skins • United States actress noted for her one-woman shows (1901-1979) • a worker who drives mules • United States psychologist and a leading proponent of behaviorism (1904-1990) | ||||||||
| nerving | 7 | 11 | adjectiveadj | |||||
noun • any bundle of nerve fibers running to various organs and tissues of the body • the courage to carry on • impudent aggressiveness verb • get ready for something difficult or unpleasant | ||||||||
| einkorn | 7 | 11 | nounn | |||||
noun • Einkorn wheat. | ||||||||
| thinner | 7 | 10 | adjectiveadj | |||||
noun • a diluting agent | ||||||||
| funnier | 7 | 10 | adjectiveadj | |||||
noun • an account of an amusing incident (usually with a punch line) adjective satellite • arousing or provoking laughter • beyond or deviating from the usual or expected • not as expected • experiencing odd bodily sensations | ||||||||
| inferno | 7 | 10 | nounn | |||||
noun • (Christianity) the abode of Satan and the forces of evil; where sinners suffer eternal punishment • any place of pain and turmoil • a very intense and uncontrolled fire | ||||||||
| vintner | 7 | 10 | nounn | |||||
noun • someone who sells wine • someone who makes wine | ||||||||
| environ | 7 | 10 | verbv | |||||
verb • extend on all sides of simultaneously; encircle | ||||||||
| innerly | 7 | 10 | ||||||
adjective • Inward; deep-seated. adverb • Within; inwardly. | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (89)
reunionearningthinnerrentingskinnerfunnierinfernospinnergrannierendingberninisunniervintnerriemannnervingbonnierrunnierenvironentrainunrisentrannieternioninsnaredinnersengraininsanerintonergrinnedcannierinnerlynegroniinternssinnerspinnersringent
...View all with 7 letters...
Phrases (3)
range inmine runone ironWords (218)
internetlearningengineerenteringinternalbeginnerinventoryearningarmenianearningsnitrogenenduringinherentinfernalreigningensuringnigerianreinventnutrientrenewingskinniersneeringrefiningreliningenvironsneutrinoripeninginfringeraveningintranetunerringunrinsedinlandersaarinenenraging
...View all with 8 letters...
Phrases (14)
nine ironnose ringbroken intv dinnernan riverpine fernin one earinhere inbin linerin return
...View all with 8 letters...
Words (574)
wonderinginsurancereturningansweringremainingwanderingargentinaentertaincontainerignorancenorwegianinventoryscreeninguncertainprominentintervenegardeningprincetonreasoningleningradnevermindferdinandbernsteinundermineparentingreckoninglingeringgoverningtangerinerenderingadrenalincenturionincarnateserotonininsertion
...View all with 9 letters...
Phrases (43)
in earnestfrown linelemon rindrain dancesiren songtennis proindian redb. f. skinnerulnar veinrhone wine
...View all with 9 letters...
Words (936)
generationpretendinginstrumentincreasingconcerningadrenalinequarantinerenovationingredientlaunderinginternshipconversiondinnertimeconqueringgeneratingunderlyinginternallypreventionintervenedintolerantfingernailinherentlyundergoingrenovatingunfriendlythunderingencryptionplunderingincendiarywindscreenresoundingconversingunderminedrefinementinternment
...View all with 10 letters...
Phrases (93)
john napierushering innext friendenergy unitthin personcenter linechicken runstring lineedna o'briengoing under
...View all with 10 letters...
Words (1204)
interestingenvironmentanniversarythreateningconsideringfrighteningengineeringrecognitioninheritanceresignationinterferingencouragingconditionerfingerprintorientationindifferentrenaissanceentertaineduncertaintyneighboringinteractionterminationpremonitionintegrationrecognizingentertainerpenetratingundertakingnourishmentchristeningincineratedconnoisseurdetermininghibernationarraignment
...View all with 11 letters...
Phrases (186)
breathing inline drawingin agreementwormian bonehanding overinverse sinetransit linesingle entrygenus pernismooring line
...View all with 11 letters...
Words (1396)
conversationpresentationinstrumentalkindergartenentertainingexperiencinginterferenceinterventionincreasinglyimprisonmentcongregationintersectiontransferringinterruptionfrankensteinveterinarianpenitentiaryconservationindifferencesynchronizedregenerationinsurrectionneighbouringintermissioninterpretinginvulnerableapprehensionintermittentinterceptionindiscretionunresponsivemispronounceinfringementfraternizinghypertension
...View all with 12 letters...
Phrases (282)
grain cleanercarniolan beejan tinbergengenus sardinaperoneal veinmount rainierkitchen rangenorthern pikecarving knifegenus syringa
...View all with 12 letters...
Words (1273)
internationalunderstandingentertainmentdemonstrationconcentrationinterrogationgrandchildrenconsiderationenvironmentalmisunderstanddeterminationreincarnationmediterraneanunnecessarilyconcentratinginexperiencedcongressionalinterrogatingexterminationcomprehensiondemonstratinginconsiderateinterestinglyreunificationreinforcementstrengtheningcorrespondingimpersonatingquestionnairecontraceptioninadvertentlyincarcerationuninterestingmerchandisingpredominantly
...View all with 13 letters...
Phrases (426)
direct antonymmeasuring unitgrain merchantbedside mannerinventory itemfire insuranceline engravingbrandy snifternursing bottleturbinate bone
...View all with 13 letters...
Words (1075)
recommendationsuperintendentinterpretationrepresentationreconstructionreconciliationreconnaissanceunprofessionalgroundbreakingdisorientationinterconnectedantidepressantdisintegrationunrecognizableindiscriminateinterplanetarydisintegratingaforementionedinsurmountablemountaineeringnorepinephrinedeconstructionreorganizationinternationaleundernourishedconversationalfingerprintingnitroglycerineintermittentlyfraternizationreconnoiteringreimplantationreintroductiongeneralizationpredestination
...View all with 14 letters...
Phrases (554)
negeri sembilanprotein foldinggarageman's lienclementine treecount per minutegenus narcissussir john tennielbelgian griffonsurface tensionterra incognita
...View all with 14 letters...
Words (908)
internationallyexperimentationenvironmentallypersonificationentrepreneurialdisenfranchisedinterchangeabledifferentiationunsportsmanlikemisapprehensionparthenogenesiscontraindicateduncontroversialdifferentiatinginstrumentationplenipotentiarypretentiousnessnonprofessionalamericanizationrevolutionizingneoconservativeinterventionistconservationistinterconnectiontrinitrotolueneinstrumentalityenfranchisementinvulnerabilityuncomplimentaryomnidirectionalnonexperimentalcounterirritantunparliamentaryunrighteousnessnonintervention
...View all with 15 letters...
Phrases (650)
italian dressingjunction barrierhigh renaissancenewton's first lawnewton's third lawprivate nuisancealpine sunflowerrepublic of benincuban revolutiongenus priodontes
...View all with 15 letters...
Words (392)
misunderstandingincomprehensibleintercontinentalenvironmentalistindiscriminatelyneurotransmittergastrointestinaltranscontinentalincontrovertibleincomprehensiblyenvironmentalismcounteroffensivecountersignaturetriphenylmethanetransubstantiaterepresentationalhyperintelligentcounterespionagecounterintuitivehyperventilationentrepreneurshipundernourishmentreinterpretationnonrevolutionarydemineralizationdenaturalizationintraventricularovercompensationinterpretationalinterventricularincontrovertiblyteleconferencingpredeterminationunattractivenessunprofessionally
...View all with 16 letters...
Phrases (617)
tympanic membranein a beastly manneritalian greyhoundgenus angiopterispresident johnsonchelonian reptilechristian huygenssonic depth finderdefinite integralaleksandr borodin
...View all with 16 letters...
Words (277)
immunosuppressiondepersonalizationconversationalistcounterinsurgencymisinterpretationintergovernmentalimmunosuppressanttranscendentalismmisrepresentationcounterrevolutiondeconstructionistreconstructionismreconstructionistcomprehensivenesstranscendentalistinappropriatenessdisinterestednessinterrelationshipinterdisciplinaryinterdepartmentalantirevolutionarycounterscientificcountersignaturessuperintelligenceantischizophreniaantischizophrenicmiscomprehensionsthermoluminescentuniversalizationsdeconstructionisminformativenessesunobtrusivenessescountersuggestionserious-mindednesskindheartednesses
...View all with 17 letters...
Phrases (678)
horizontal sectionobject recognitionjacqueline cochranmary leontyne pricecompetence hearingjohn moses browningczech monetary unitnikolaas tinbergenhandicapped personcuban monetary unit
...View all with 17 letters...
Words (163)
compartmentalizinginternationalizinginterconnectednessdisenfranchisementoverrepresentationinterchangeabilitythermoluminescencehypersensitivenesshypersensitizationmisinterpretationscountersuggestionsnoncomprehensivelyinharmoniousnessesmisrepresentationsdishonorablenessesfaintheartednesseslandlubberlinessesunprinciplednessesrambunctiousnessesunprofitablenessesapprehensivenessesdisintermediationsunresponsivenessescompartmentalisingunrestrainednessespostmillenarianismanthropocentricitynonrepresentativesnonrevolutionariestranscendentalismscomprehensiblenesstranscendentalistscurmudgeonlinessesreconstructionismsvaingloriousnesses
...View all with 18 letters...
Phrases (634)
hindu calendar monthbusiness enterpriseamerican revolutiondrafting instrumentpresident jeffersonanamnestic reactionadministrative unitandropogon gerardiiafghan monetary unitrenaissance revival
...View all with 18 letters...
Words (121)
counterintelligenceelectroluminescencethermoluminescencesdisenfranchisementshypersensitizationscountersurveillanceextraordinarinessesprofessionalisationunpretentiousnessesprofessionalizationultracentrifugationnonproductivenessesdisinterestednessesparthenogeneticallysplendiferousnessespostmillenarianismsnonrelativisticallycomplementarinessesuntranslatabilitiesreconceptualizationcomprehensivenessesresorcinolphthaleincytodifferentiationlanguedoc-roussillonimmunofluorescencesmagnetohydrodynamictransplantabilitiesgedankenexperimentsreindustrializationimmunoprecipitatingimmunoprecipitationreinstitutionalizedreinstitutionalizesintercommunicationsdehydrochlorinating
...View all with 19 letters...
Phrases (582)
water-plantain familymeasuring instrumentrecursive definitionitalian monetary unitsuperior conjunctionhydrastis canadensislatvian monetary unitread between the lineszairese monetary unitbarren ground caribou
...View all with 19 letters...
Words (68)
counterrevolutionarycompartmentalizationinternationalizationtetrahydrocannabinolparadichlorobenzeneshypersensitivenesseskeratoconjunctivitescountersurveillancesunrepresentativenesscounter-revolutionistunsatisfactorinessesreconceptualizationscomprehensiblenessescounterdemonstrationcytodifferentiationsphenylpropanolaminesreindustrializationsinterchangeabilitiesimmunoprecipitationsphiloprogenitivenessreinstitutionalizingneuroendocrinologiescounterrevolutionistneuroendocrinologistinterconnectednessesdehydrochlorinationsdeindustrializationsadrenocorticotropinselectroluminescencesrepresentationalismsrepresentationalistsbuckminsterfullerenerepresentativenessesultracentrifugationsadrenocorticotrophin
...View all with 20 letters...
Phrases (492)
sweet-scented geraniumhonduran monetary unitappendicular skeletonpara aminobenzoic acidprofessional relationdwarf flowering almondmalawian monetary unitinstruction executionlebanese monetary unitbusiness organisation
...View all with 20 letters...
Words (20)
disestablishmentariancompartmentalizationsestablishmentarianisminterchangeablenessesneuroendocrinologicalneuroendocrinologistsinterconvertibilitiesadrenocorticotrophinsotorhinolaryngologiesbuckminsterfullerenesdendrochronologicallyinternationalizationsincomprehensibilitiesarenaria-melanocephalacounterdemonstrationsoverintellectualizingantiferromagneticallyundemonstrativenessescounterinterpretationtetrahydrocannabinolsPhrases (428)
administrative hearingelimination tournamentsierra nevada mountainsexperimental conditionicelandic monetary unitelectrolytic condenseraleksandr solzhenitsynmalaysian monetary unitexecution of instrumentbulgarian monetary unit
...View all with 21 letters...
Words (14)
counterrevolutionarieskeratoconjunctivitideskeratoconjunctivitisesdisestablishmentariansunrepresentativenessesnonrepresentationalismreinstitutionalizationphiloprogenitivenessesintercomprehensibilityhexamethylenetetramineincomprehensiblenessesdihydroxyphenylalanineestablishmentarianismscounterinterpretationsPhrases (356)
venezuelan monetary unitlycopersicon esculentumadministrative divisiongregorian calendar monthprunus persica nectarinatransient global amnesianavigational instrumentleishmaniasis americanaaleksandr i. solzhenitsyninstrument of punishment
...View all with 22 letters...
Words (4)
nonrepresentationalismsreinstitutionalizationshexamethylenetetraminesoverintellectualizationPhrases (258)
gilbert and ellice islandsparenthetical expressiontransient ischemic attackchlorpheniramine maleateto all intents and purposesyellowstone national parkkazakhstani monetary unitparis-sorbonne universityinterlocutory injunctionlewis and clark expedition
...View all with 23 letters...
Words (3)
laryngotracheobronchitisintercomprehensibilitiesoverintellectualizationsPhrases (220)
carnegie mellon universityprofessional organisationprofessional organizationlowland burrowing treefrogargyroxiphium sandwicensedivision heterokontophytamary wollstonecraft godwinzollinger-ellison syndromesir terence mervyn rattigandistinguished flying cross
...View all with 24 letters...
Words (1)
antiestablishmentarianismPhrases (175)
count ferdinand von zeppelincluster of differentiation 4diamond wedding anniversarycruel and unusual punishmentcentral intelligence agencyfast local internet protocolboris leonidovich pasternakwar of the spanish successionsecret intelligence serviceantonio allegri da correggio
...View all with 25 letters...
Phrases (112)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettx-linked dominant inheritancesir sarvepalli radhakrishnanpolicing and enforcement costalternanthera philoxeroidescorrectional rehabilitationhunting and gathering society
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (95)
business environment analysispartial differential equationamerican revolutionary leaderaleksandr sergeyevich pushkinelectromechanical transducersolenostemon scutellarioidesnational labor relations boardaugustus welby northmore puginbeta-adrenergic blocking agentelectronic musical instrument
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (98)
interstate commerce commissionaleksandr feodorovich kerenskybusiness process reengineeringbureau of engraving and printingephippiorhynchus senegalensistriphosphopyridine nucleotidemarcus junius brutus the youngerdistinguishing characteristiccardiopulmonary resuscitationbattles of lexington and concord
...View all with 28 letters...
Phrases (72)
business environmental analysisbusiness interruption insurancealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organnational volunteers associationdisorganized type schizophreniacombination in restraint of trade
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (58)
valentina vladmirovna tereshkovareduced instruction set computingalexander isayevich solzhenitsynglutamic oxalacetic transaminaseself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencecoluber constrictor flaviventrisjacques anatole francois thibaultdepository financial institution
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (60)
great smoky mountains national parkbureau of intelligence and researchfreedom from involuntary servitudepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movementsidonie-gabrielle claudine coletteunited states trade representativefrances elizabeth caroline willard
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (30)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databaseweakly interacting massive particleintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationobject-oriented programing languagecount nikolaus ludwig von zinzendorf
...View all with 32 letters...
Phrases (31)
linear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languagecongress of industrial organizationslycopersicon esculentum cerasiformeobject-oriented programming languageorganization of the oppressed on earth
...View all with 33 letters...
Phrases (31)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal national mortgage associationacademy of television arts and sciencesnero claudius caesar drusus germanicuscosmic microwave background radiationinterstitial cell-stimulating hormonemusculus sphincter ductus pancreatici
...View all with 34 letters...
Phrases (27)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycomte donatien alphonse francois de sade
...View all with 35 letters...
Phrases (21)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtjuan carlos victor maria de borbon y borbonfield-sequential color television systemfreedom from cruel and unusual punishmentalbert francis charles augustus emmanueltransportation security administration
...View all with 36 letters...
Phrases (17)
severe combined immunodeficiency diseaseunited states declaration of independencetheodore roosevelt memorial national parkuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiongenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratory
...View all with 37 letters...
Phrases (9)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemdemocratic republic of sao tome and principeinternational civil aviation organizationeconomic commission for asia and the far eastdepartment of housing and urban developmentadvanced research and development activityminimally invasive coronary bypass surgeryPhrases (11)
million floating point operations per secondbillion floating point operations per seconddefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestinebaron hermann ludwig ferdinand von helmholtz
...View all with 39 letters...
Phrases (10)
association of islamic groups and communitiesminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenregents of the university of california v. bakkeinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance grouptrillion floating point operations per secondPhrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (8)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (6)
abul-walid mohammed ibn-ahmad ibn-mohammed ibn-roshdassociation for the advancement of retired personsprayer of azariah and song of the three holy childrenconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (6)
international bank for reconstruction and developmentfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationsunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing
