Words Containing: R,A,N,C
(In Any Order)
There are 14,409 words,
11,784 phrases and
0 abbr's with
R,A,N,C in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
uncrazy | 7 | 21 | verbv | |||||
Valid word for Scrabble US
| ||||||||
crazing | 7 | 19 | ||||||
noun • an interest followed with exaggerated zeal • state of violent mental agitation • a fine crack in a glaze or other surface verb • cause to go crazy; cause to lose one's mind • develop a fine network of cracks | ||||||||
czarina | 7 | 18 | nounn | |||||
noun • the wife or widow of a czar | ||||||||
knacker | 7 | 17 | verb, nounv, n | |||||
noun • someone who buys old buildings or ships and breaks them up to recover the materials in them • someone who buys up old horses for slaughter | ||||||||
branchy | 7 | 17 | adjectiveadj | |||||
adjective • having many branches | ||||||||
crankly | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
anarchy | 7 | 15 | nounn | |||||
noun • a state of lawlessness and disorder (usually resulting from a failure of government) | ||||||||
cranky | 6 | 15 | adjectiveadj | |||||
adjective satellite • (used of boats) inclined to heel over easily under sail • easily irritated or annoyed | ||||||||
scrawny | 7 | 15 | adjectiveadj | |||||
adjective satellite • being very thin • inferior in size or quality | ||||||||
raunchy | 7 | 15 | adjectiveadj | |||||
adjective satellite • earthy and sexually explicit • suggestive of or tending to moral looseness • thickly covered with ingrained dirt or soot | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (351)
certaincentralnuclearromanceafricanscaringcleanercurtainorganiccartooncaravananarchyscannercravingcarmineunclearfurnaceraccooncarvingfrantictracingcarnagescrawnymonarchlarcenyarseniccochrancranialmarconirackingcraniumtantricprancercarrioncrewman
...View all with 7 letters...
Phrases (12)
car hornbeer canarc sineen clairtank carcrank upmarch oncow barncar loancrawl in
...View all with 7 letters...
Words (787)
americancriminalcontractromanticcarryingcharmingentrancereactionchairmanincreasecreatingveronicacontrarycreationtrackingreachinglawrencecarolinecrawlingcurtainscrashingcrackingcalendarscenarioclearingcarolinachargingcarnivalclarencemerchantcreakingmarchingcardinalcongratscleaners
...View all with 8 letters...
Phrases (52)
bean curddry cleanon cameracorn cakecape horncarbon 14acorn cupcarl junglace ferncrna gora
...View all with 8 letters...
Words (1341)
certainlyscreamingnecessaryaccordinginsurancecommanderchristiansearchingprincipalcatherineannouncerpregnancyincreasedencouragebarcelonahurricanefragrancecarpentersecondarycontainercertaintyignorancecaribbeancameramanmachineryclearancesanctuaryarrogancetolerancereplacingaccordioncassandracracklinguncertainpreaching
...View all with 9 letters...
Phrases (162)
genus craxcary grantjoan of arccow manurepecan treesugar corncut-and-drygenus acerhue and cryrain check
...View all with 9 letters...
Words (1811)
californiachatteringbackgroundappearanceresistancepracticingconspiracyimportanceattractionscreenplaymanchesterincreasingtranscriptrepublicandictionaryscratchingencouragedcinderellacontractormanuscriptcomparisonapprenticepercentagechancellorbankruptcybinocularsdecorationantarcticagrandchildprecautioncoordinateprovincialcontractedcoronationaccordance
...View all with 10 letters...
Phrases (307)
air cleanerline backerair currentlarus canustouring carcanopic jard. h. lawrencejapan cedarbacon stripcanary bird
...View all with 10 letters...
Words (2197)
performanceconcentrateapproachingnecessarilycelebratingcelebrationdocumentarycorporationcooperationreplacementunnecessarycoordinatesinheritancecompartmentcongressmandistractionmerchandisedeclarationcirculationtraffickingdisturbanceencouragingmanufactureconsiderateresemblancetransactioncommentatoraccordinglyelectricianrenaissancechamberlainthunderclapmercenariesuncertaintycredentials
...View all with 11 letters...
Phrases (424)
isaac singergenus crambeflower chainracing startcrank handleacceptor rnatv announcerbean counterbitter pecansheet anchor
...View all with 11 letters...
Words (2111)
conversationsurveillancecongratulateconfirmationchristianityconservativehandkerchiefincreasinglyappreciationconcentratedbroadcastingcontemporaryconsiderablecongregationcheerleadingcircumstancemanufacturedmanufacturerdisciplinaryconservatorytransactionsincorporatedastronomicalperseveranceconservationconsiderablyacceleratingcoordinationpornographicunattractiveincarceratedexcruciatingproclamationpediatriciancorrectional
...View all with 12 letters...
Phrases (639)
carnauba palmgrain alcoholgrain cleanercarniolan beegeorge m. cohanhunch forwardlunar caustichead coveringcharnel housecovered stand
...View all with 12 letters...
Words (1903)
circumstancesuncomfortableconcentrationgrandchildrenconsiderationdisappearanceunpredictablecontroversialreincarnationunnecessarilyconfrontationparticipatingconcentratingcollaborationparticipationencouragementcontradictionmanufacturingschizophreniacongressionalpronunciationcongratulatedinconsiderateincriminatingcontradictoryvaledictorianconfigurationcounterattackreunificationcomplimentaryclarificationcollaboratingindescribableschadenfreudegratification
...View all with 13 letters...
Phrases (873)
upton sinclairdwarf chestnutharvey cushingjohn mccormacklarix laricinadirect antonympar excellencechelone glabramuscular tonusisadora duncan
...View all with 13 letters...
Words (1510)
recommendationdiscriminationreconciliationinfrastructurereconnaissancecongratulationcinematographyuncontrollablecircumstantialcongratulatingelectronicallyapprenticeshipuncontrollablycriminalisticsunrecognizablecontemporariesindiscriminatediscriminatingundersecretarytranscendentalelectroplatingpancreatectomynebuchadnezzarunsatisfactoryindoctrinationthermodynamicscholinesteraseattractivenesscongratulatorydisciplinarianindecipherableconversationalexcruciatinglyscatterbrainedconservatively
...View all with 14 letters...
Phrases (1052)
direct contrastmarc blitzsteinprivate citizengenus sarcopteslachrymal glandbreathing placetheodor schwannbreathing spacetalcott parsonsgenus narcissus
...View all with 14 letters...
Words (1090)
congratulationselectromagneticcinematographersynchronizationpithecanthropusconfrontationalpersonificationdisenfranchisedinterchangeableprognosticationunpronounceableintercollegiateanthropologicalprocrastinatingprocrastinationdemocratizationchronologicallysynergisticallycontraindicatedcrystallizationuncontroversialcinematographicdiversificationanthropomorphicinterscholasticparentheticallyamericanizationaerodynamicallyneoconservativecardiopulmonarysynchronisationconservationistenfranchisementcontroversiallyvasoconstrictor
...View all with 15 letters...
Phrases (1090)
measuring deviceallium carinatumiridaceous plantcapital of francecentaurea cyanuscharlotte brontefalco peregrinusjunction barrierhonduran capitalhigh renaissance
...View all with 15 letters...
Words (453)
intercontinentalindiscriminatelyelectromagnetismundersecretariestranscontinentalcharacterizationcountersignaturecircumambulatingunpredictabilitycounterespionageuncharacteristicjournalisticallyelectromagneticsmultidirectionalcircumstantiallytrichotillomaniavasoconstrictionintraventricularovercompensationovercomplicatingnonparticipationinterventricularindiscriminationcollaborationistthrombocytopeniareclassificationcharacterisationoverenthusiasticcircumnavigatingcompartmentalizeunattractivenessdecentralizationunderachievementconversationallycollaborationism
...View all with 16 letters...
Phrases (1053)
tympanic membraneczar alexander iiigenus utriculariaarnica cordifoliagenus crassostreagenus elaeocarpusstrictly speakingchelonian reptilechristian huygensfamily cyprinidae
...View all with 16 letters...
Words (307)
conversationalistcommercializationtranscendentalismanthropologicallycompartmentalizedcontemporaneouslythermodynamicallytranscendentalistphilanthropicallycompartmentalisedelectromechanicalmultidisciplinaryuncomfortablenessinterdisciplinaryself-contradictorycountersignaturesantischizophreniainextricabilitiesirrevocablenessesantischizophreniccounterstatementsisoelectronicallyparadoxicalnessespolymorphonuclearcomfortablenessescounterstrategiescounterstrategistmispronunciationsnonparticipationsdisfranchisementsdisgracefulnessesmistranscriptionscountertraditionsultraconservativemonochromatically
...View all with 17 letters...
Phrases (1099)
horizontal sectionwilliam stricklandjacqueline cochranlarix occidentalismary leontyne pricecompetence hearingdirect correlationpontederia cordatarobert falcon scottlandscape gardener
...View all with 17 letters...
Words (169)
compartmentalizingoversimplificationtransmogrificationdisenfranchisementinterchangeabilityneuropsychologicalpolyesterificationpolymorphonuclearscommensurabilitieselectrodynamometercommercializationscounterstrategistsunpredictabilitiesrambunctiousnessesappreciativenessesmonochromaticitiesparticularizationsarchaeoastronomiescompartmentalisingultranationalisticpentachlorophenolsanthropocentricitycylindrical-stemmedrechromatographingcounterbombardmenttranscendentalismstranscendentalistsenterobacteriaceaeaustralopithecinesperpendicularitiesmacroglobulinemiasrecrystallizationslacto-vegetarianismcongregationalismspertinaciousnesses
...View all with 18 letters...
Phrases (1005)
hindu calendar monthbombycilla cedrorunerinaceus europaeusamerican revolutionanamnestic reactionprivate corporationeriobotrya japonicalachrymal secretionfreudian psychologygenus styracosaurus
...View all with 18 letters...
Words (121)
countertransferencesternocleidomastoidpneumoencephalogramcinematographicallypolyesterificationsdisenfranchisementsextralinguisticallycountersurveillanceultracentrifugationparthenogeneticallycrosslinguisticallynonrelativisticallycomplementarinessesglottochronologicalreconceptualizationposttranscriptionalresorcinolphthaleincounterdemonstratoranarcho-collectivismcytodifferentiationlanguedoc-roussillonperspicaciousnessesmagnetohydrodynamicpharmacodynamicallytransmogrificationsgastroenterologicalphenylthiocarbamideimmunoprecipitatingimmunoprecipitationintercommunicationsphonocardiographiesechoencephalographyauriculoventriculardehydrochlorinatingcross-classification
...View all with 19 letters...
Phrases (796)
favourable receptionmuscular contractionerinaceus europeaeusscandinavian countryrejoicing over the lawseventeen-year locusthydrastis canadensisallium schoenoprasumcollective agreementalpine type of glacier
...View all with 19 letters...
Words (65)
counterrevolutionaryuncharacteristicallycompartmentalizationoverenthusiasticallytetrahydrocannabinolelectroencephalogramparadichlorobenzeneskeratoconjunctivitescountersurveillancescountertransferencesunsatisfactorinessesreconceptualizationshyperadrenocorticismcounterdemonstrationcytodifferentiationsphenylthiocarbamidesinterchangeabilitiesimmunoprecipitationsacetylcholinesteraseoophorosalpingectomydehydrochlorinationsadrenocorticosteroidadrenocorticotropinsneuropharmacologicalphosphofructokinasesneuropharmacologistsneurophysiologicallyneuropsychiatricallycontradistinguishingadrenocorticotrophicultracentrifugationsadrenocorticotrophinmagnetohydrodynamicsinappreciativenessesanthropocentricities
...View all with 20 letters...
Phrases (676)
sweet-scented geraniumarcheological remainspelecanus onocrotalusappendicular skeletonpara aminobenzoic acidphotographic emulsionlunar excursion moduleindirect transmissionoryctolagus cuniculusmarchantia polymorpha
...View all with 20 letters...
Words (22)
electroencephalographcompartmentalizationsconstructive-metabolicinterchangeablenessesacetylcholinesterasesneuroendocrinologicalelectroencephalogramscontemporaneousnessesadrenocorticosteroidsadrenocorticotrophinsdendrochronologicallyovercommercializationelectroretinographiespseudocholinesterasesarenaria-melanocephalacountercountermeasuremicrominiaturizationscounterdemonstrationsoverintellectualizingantiferromagneticallycounterinterpretationtetrahydrocannabinolsPhrases (544)
use of goods and servicesacrocentric chromosomesierra madre occidentalfrances hodgson burnettexperimental conditionhelianthemum scopariumicelandic monetary unitanaphalis margaritaceadiametrical oppositionigor ivanovich sikorsky
...View all with 21 letters...
Words (10)
counterrevolutionarieskeratoconjunctivitideskeratoconjunctivitiseselectroencephalographselectroencephalographyotorhinolaryngologicalovercommercializationsencephalomyocarditisescountercountermeasurescounterinterpretationsPhrases (441)
administrative districtgregorian calendar monthprunus persica nectarinaadministrative officialschlumbergera truncatuscoronavirus disease 2019trazodone hydrochloridebarbara wertheim tuchmanleishmaniasis americanasir laurence kerr olivier
...View all with 22 letters...
Words (5)
electroencephalographichydrochlorofluorocarbonelectroencephalographeroverintellectualizationdichlorodifluoromethanePhrases (325)
gilbert and ellice islandsparenthetical expressiontransient ischemic attackgeorge macaulay trevelyanchlorpheniramine maleateelectromechanical devicesir richard francis burtonthryothorus ludovicianuspharmacological medicineapium graveolens rapaceum
...View all with 23 letters...
Words (5)
laryngotracheobronchitiselectroencephalographerselectroencephalographiesoverintellectualizationsdichlorodifluoromethanesPhrases (246)
carnegie mellon universityargyroxiphium sandwicensesubdivision deuteromycotamary wollstonecraft godwinprivately held corporationtrip the light fantastic toecapture of fort ticonderogasir terence mervyn rattiganrubus ursinus loganobaccusfrancois auguste rene rodin
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (215)
count ferdinand von zeppelinunited states secret serviceembryonal rhabdomyosarcomacluster of differentiation 4cosmic microwave backgroundbalaenoptera acutorostratabureau of justice assistanceigor fyodorovich stravinskymary wollstonecraft shelleymiguel de cervantes saavedra
...View all with 25 letters...
Phrases (138)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkbattle of monmouth court housefrances eliza hodgson burnettshort-spurred fragrant orchidx-linked dominant inheritanceconfederate states of americaright atrioventricular valvebrassica oleracea gongylodes
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (101)
american revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelelectromechanical transducersolenostemon scutellarioidesdirector-stockholder relationtransmission control protocol
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (100)
interstate commerce commissionaleksandr feodorovich kerenskyephippiorhynchus senegalensisoxytetracycline hydrochloridemarcus junius brutus the youngerstrategic arms limitation talksgallinula chloropus cachinnansdistinguishing characteristiccardiopulmonary resuscitationmicrosoft disk operating system
...View all with 28 letters...
Phrases (79)
business interruption insurancealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organnational volunteers associationdisorganized type schizophreniaautomatic data processing systemcombination in restraint of trade
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (53)
battle of spotsylvania court housebattle of spotsylvania courthousemusculus sternocleidomastoideusalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalitybachelor of arts in library sciencedepartment of energy intelligencecoluber constrictor flaviventrisjacques anatole francois thibault
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (56)
united states public health servicebureau of intelligence and research2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verditupac amaru revolutionary movementsidonie-gabrielle claudine colettesir john frederick william herschelfrances elizabeth caroline willardrevolutionary proletarian nucleus
...View all with 31 letters...
Phrases (36)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpatent and trademark office databasehierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationobject-oriented programing language
...View all with 32 letters...
Phrases (34)
linear-quadratic-gaussian controllermusical instrument digital interfacebreach of trust with fraudulent intentcongress of industrial organizationslycopersicon esculentum cerasiformeobject-oriented programming languagemusculus abductor digiti minimi manusmusculus abductor digiti minimi pedisbureau of alcohol tobacco and firearmsmusculus obliquus externus abdominis
...View all with 33 letters...
Phrases (28)
jacques francois fromental elie halevyconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal national mortgage associationacademy of television arts and sciencesnero claudius caesar drusus germanicuscosmic microwave background radiationinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitz
...View all with 34 letters...
Phrases (20)
national technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkocomte donatien alphonse francois de sadecanadian security intelligence serviceimmaculate conception of the virgin marycockcroft and walton voltage multiplier
...View all with 35 letters...
Phrases (24)
center for disease control and preventionrank-difference correlation coefficientsecretary of state for the home departmentangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsjuan carlos victor maria de borbon y borbonfield-sequential color television systemfreedom from cruel and unusual punishmentalbert francis charles augustus emmanuel
...View all with 36 letters...
Phrases (20)
severe combined immunodeficiency diseaseunited states declaration of independenceketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeriagenerally accepted accounting principlesdemocratic socialist republic of sri lankatrivalent live oral poliomyelitis vaccine
...View all with 37 letters...
Phrases (9)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeinternational civil aviation organizationeconomic commission for asia and the far eastadvanced research and development activityminimally invasive coronary bypass surgeryPhrases (10)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencegates of the arctic national park and preservenucleoside reverse transcriptase inhibitorfuerzas armadas revolucionarios de colombiaenzyme-linked-immunosorbent serologic assayPhrases (11)
association of islamic groups and communitiesminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance group
...View all with 40 letters...
Phrases (7)
national aeronautics and space administrationorganization of petroleum-exporting countriesnational institute of standards and technologyfirst of october anti-fascist resistance groupsoccupational safety and health administrationship-towed long-range acoustic detection system5-hydroxy-3-methylglutaryl-coenzyme a reductasePhrases (8)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (6)
association for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (6)
international bank for reconstruction and developmentfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationsunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing