Words Containing: P,Y,D,N
(In Any Order)
There are 894 words,
1,064 phrases and
0 abbr's with
P,Y,D,N in.
Best Scoring Words With: P,Y,D,N
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| hypnoid | 7 | 16 | adjectiveadj | |||||
adjective satellite • of or relating to a state of sleep or hypnosis | ||||||||
| pudency | 7 | 15 | nounn | |||||
noun • Modesty. | ||||||||
| spindly | 7 | 13 | adjectiveadj | |||||
adjective satellite • long and lean | ||||||||
| dyspnea | 7 | 13 | nounn | |||||
noun • difficult or labored respiration | ||||||||
| endplay | 7 | 13 | verb, nounv, n | |||||
noun • A tactical play in which a defender is put on lead at a strategic moment, and then has to make a play that loses one or more tricks verb • To make an endplay | ||||||||
| spendy | 6 | 12 | adjectiveadj | |||||
adjective • Expensive, costly. | ||||||||
| pandy | 5 | 11 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
spendyWords (48)
underpaydownplaypandowdypedantrydiphenyldyspnealpunditrysyphoneddeprenylphoneyedsynapsedunplayedpyridinedrypointhyphenedependymaupdryingrepandlyendplayspyranoidsynapsidpandyingdyspneaspyrenoiddyspnoiccypriniddiaphonymonopodydyspneicdyspnoeaduopsonypycnidiaplaydownpendencyplayland
...View all with 8 letters...
Phrases (6)
drying uppond lilylindy hopdry pointpink ladyplay downWords (68)
pseudonympointedlyprudentlyendoscopyunderplaydystopiandayspringhypnoidalunadeptlyimpudencyparodyingpyridoxincyprinidsinsipidlyunsprayeddrypointsdeployingencrypteddynorphinamplidyneendplayeddownplaysdysphonicdyspnoeaspyrenoidsdeprenylsependymaspyridinescyprinoidpycnidiumnymphaliddysphoniadopeynesslinotypedsynapsids
...View all with 9 letters...
Phrases (10)
point dutywood nymphwild pansytroy poundlymph nodewind poppyspin dryermonkey podkiddy pornkidney pieWords (118)
unemployedplaygroundpresidencyprofoundlyhypnotizeddeploymentdependencysplendidlydispensaryhydroponichypnotisedepicondyleprofundityintrepidlyhydrophonehyphenatedimpudentlydecryptionsyncopatedhydroplaneexpediencyadenopathyglyptodontinsipiditydependablypardonablyunderplayssandpaperydownplayedaneuploidydecryptingdisplayingsynopsizedpostsyncedploddingly
...View all with 10 letters...
Phrases (14)
woody plantfield pansypineal bodypaddy wagonlymph glandpalm sundaycandy applepolling dayindian ponygwyn ap nudd
...View all with 10 letters...
Words (132)
discrepancyserendipityhydroponicsexpedientlydespondencyintrepidityimprudentlyspondylitisstipendiaryunderplayedpyroxenoidshyperlinkedlapidifyingpodophyllinhypermoderndownplayinghyperextenddecryptionshydroplanedhydroplanespyridoxinesdiaphaneitypretendedlycopyeditingprovidentlycopyreadingdependentlyunderpayingredeployingstaphylinidantityphoidinterplayedpolyandriesdodecaphonypyranosides
...View all with 11 letters...
Phrases (31)
dinner partycopy editingjoseph haydnsyrian poundblood typingspiny lizardplaying cardhorned poppygarden partycynipid wasp
...View all with 11 letters...
Words (111)
unexpectedlydisciplinaryencyclopediaappendectomyhypochondriaindisputablydepressinglydespairinglyencyclopedicredeploymenthypogonadismphotodynamicunpardonablyhydroplaningrehypnotizedindependencystupendouslypedanticallydespondentlyresplendencyunderplayingprudentiallyunhyphenatedpodophyllinstypefoundingdiaphanouslycodependencypremodifyingopenhandedlyhyperendemicdiscrepantlyinexpediencystaphylinidspaddywackingimponderably
...View all with 12 letters...
Phrases (35)
shetland ponydisplay panelcyanide groupcandy striperinjured partyplatonic bodyiceland poppyspiny dogfishgypsy dancingplaying field
...View all with 12 letters...
Words (107)
independentlypredominantlyhypochondriacexpeditionaryencyclopaediadependabilitypredominatelydisparaginglyendolymphaticencyclopaedicunpredictablyresplendentlyencyclopedistredeploymentshyperinflatedencyclopediascompendiouslylymphadenitisdeprecatinglyanaphylactoidexpandabilityopenheartedlyinexpedientlyexpendabilitypolybutadienehypochondriasaptitudinallydryopithecineopinionatedlypsychodynamicencyclopedismpyridoxaminesperiodontallypolysyndetonstypefoundings
...View all with 13 letters...
Phrases (49)
battle of pydnagenus bradypuspraying mantidjapanese deitydna polymerasephrygian deitymonopoly boardegyptian deityegyptian poundlatency period
...View all with 13 letters...
Words (117)
psychodynamicsappendicectomyhydropneumaticprovidentiallydepartmentallydisapprovinglypreponderantlycyproheptadinedepolymerizingpolybutadienespolynucleotidepsychoanalyzedhyperpigmentedspellbindinglydisappointedlypreponderatelydiphenylaminesdryopithecineshyperimmunizedencyclopaediasencyclopedismsencyclopedistssimplemindedlypresidentiallydisciplinarilydisciplinaritygynandromorphsgynandromorphyhypermodernisthypochondriacsdepreciatinglydispensabilityhydroponicallyperiodontologyadaptationally
...View all with 14 letters...
Phrases (57)
pituitary glandnavy departmentdata encryptiondynamic speakerbinary compoundrudyard kiplingcyanide processphylum annelidapan troglodyteslimited company
...View all with 14 letters...
Words (78)
lymphadenopathydevelopmentallycardiopulmonarydisappointinglymethylphenidateuninterruptedlypolyunsaturatedhypochondriacalgynandromorphicdispassionatelycorrespondinglyunprecedentedlydiphenhydramineinterdependencyperpendicularlyadenohypophysishypersensitizedsidesplittinglyimponderabilityserendipitouslycyproheptadinessuperabundantlypolynucleotidessuperintendencyunderemploymentlymphadenitisessplendiferouslyhypermodernistshypochondriasesunanticipatedlypharmacodynamichyperproductionplatinocyanidesplatitudinouslydaguerreotyping
...View all with 15 letters...
Phrases (65)
spiny-headed wormshorthand typistjohnny appleseedindependence daygenus dasyproctabirthday presentdiospyros ebenumguy de maupassantmedicare paymentphyseter catodon
...View all with 15 letters...
Words (37)
unpredictabilityspondylarthritisperpendicularityindispensabilitylyginopteridalesdodecaphonicallypharmacodynamicsdniprodzerzhynskundiplomaticallyadenohypophysealadenohypophysialinterdependentlygynandromorphiesgynandromorphismchondrodystrophysuperheterodynesmethylphenidatesphotodynamicallycryptobranchidaedepolymerizationencyclopedicallypalaeodendrologypseudonymousnessendopolyploidiespseudoparenchymaepichlorohydrinsphotosynthesizeddiacetylmorphineunderemploymentshyperdevelopmentdiphenhydraminespyelonephritidessedative-hypnoticpaedogeneticallygynandromorphous
...View all with 16 letters...
Phrases (86)
hypodermic needlefamily cyprinidaegenus aptenodytesquaternary periodorder polygonalesfamily pythonidaegrand mal epilepsyflat panel displayadenomatous polypfamily panorpidae
...View all with 16 letters...
Words (26)
superconductivitymultidisciplinaryinterdisciplinaryspondylolisthesishypochondriacallylymphadenopathiestransdisciplinarythiodiphenylaminesamoyedic-speakingphonocardiographyptilonorhynchidaejurisprudentiallygynandromorphismsangiocardiographydephosphorylatingdephosphorylationdepolymerizationsdiphenylhydantoinpseudoparenchymasuncomprehendinglycounterdeploymentpsychodynamicallyhydroxytryptaminehyperdevelopmentsphotoconductivitypolycondensationsPhrases (100)
division bryophytalycopodium alpinumantipsychotic drugcylinder separatorcapital of marylandhereditary patternsubsidiary companyindependent agencygenus phyllocladusdisability payment
...View all with 17 letters...
Words (13)
disproportionatelyhyperaldosteronismpolyribonucleotidetriphosphopyridinemethylprednisolonepropagandisticallydephosphorylationspseudonymousnessespseudoparenchymatacounterdeploymentshydroxytryptaminesdimethyltryptaminediphenylhydantoinsPhrases (100)
worldly possessionsdivision anthophytafreudian psychologyread-only memory chipkilocycle per secondmegacycle per secondvictory in europe dayparkinson's syndromephoenix dactyliferap-type semiconductor
...View all with 18 letters...
Words (11)
polyribonucleotidespharmacodynamicallyphenylthiocarbamidephosphatidylcholineinterdepartmentallymethylprednisolonesencephalomyelitidesdihydrostreptomycinhypoadrenocorticismdimethyltryptaminesmedroxyprogesteronePhrases (97)
building supply housedivision schizophytadasypus novemcinctussecondary censorshipgerard manley hopkinsfixed-cycle operationdreissena polymorphafamily acipenseridaeaptenodytes forsteritransferred property
...View all with 19 letters...
Words (6)
lipochondrodystrophyhyperadrenocorticismphenylthiocarbamidesphosphatidylcholinesencephalomyocarditispseudoparenchymatousPhrases (76)
developmental anatomydivision tracheophytadianthus caryophyllusfriendly relationshipamyloid protein plaquenymphicus hollandicushyperoodon ampullatusclarence shepard day jr.agropyron intermediumlateral epicondylitis
...View all with 20 letters...
Words (1)
polyvinyl-formaldehydePhrases (59)
pseudemys rubriventriseucalyptus fraxinoidesprocaine hydrochloridecape verde monetary unitprosopium cylindraceumpercy aldridge graingersuperfamily tyrannidaeorder lyginopteridalesandromeda glaucophyllapresident john f. kennedy
...View all with 21 letters...
Words (2)
encephalomyocarditisesdihydroxyphenylalaninePhrases (62)
redevelopment authorityfamily dendrocolaptidaehigh-density lipoproteinnyctereutes procyonidesparliamentary proceduredisplaying incompetencedepartment of philosophyfamily phoenicopteridaepearl sydenstricker buckdouble-entry bookkeeping
...View all with 22 letters...
Words (1)
phosphatidylethanolaminePhrases (35)
argyroxiphium sandwicensedivision heterokontophytaprivately held corporationapocynum androsaemifoliumfederal republic of germanyoxidative phosphorylationpaul johann ludwig von heysepresident john quincy adamssubdivision cycadophytinaperfectly inelastic demand
...View all with 24 letters...
Words (1)
phosphatidylethanolaminesPhrases (26)
propoxyphene hydrochloridesuborder petromyzoniformeslepidocybium flavobrunneumtympanuchus pallidicinctuspodkamennaya tunguska riverdevelopmentally challengedsubfamily caesalpinioideaecomplementary distributioncladorhyncus leucocephalumsuperorder acanthopterygii
...View all with 25 letters...
Phrases (24)
subdivision coniferophytinaentandrophragma cylindricumcalycophyllum candidissimumscardinius erythrophthalmussuperorder labyrinthodontialeptodactylus pentadactylusnontricyclic antidepressantintermediate temporal arteryquaternary ammonium compoundclosed-end investment company
...View all with 26 letters...
Phrases (13)
holy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkindeoxyadenosine monophosphatetricyclic antidepressant drugdeoxythymidine monophosphatetopical prostaglandin eyedroprespiratory distress syndromeisobutylphenyl propionic aciddeoxyguanosine monophosphate
...View all with 27 letters...
Phrases (10)
triphosphopyridine nucleotidecardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitydissident irish republican armysingle nucleotide polymorphismaspidophoroides monopterygiuspan troglodytes schweinfurthiimethamphetamine hydrochloridestenopterygius quadrisicissusWords (1)
methylenedioxymethamphetaminePhrases (11)
antisocial personality disorderdisorganized type schizophreniaautomatic data processing systemmiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisontheory of punctuated equilibriumpressure-feed lubricating systemcypripedium calceolus pubescens
...View all with 29 letters...
Phrases (12)
department of energy intelligencedepository financial institutionsevere acute respiratory syndromemucocutaneous lymph node syndromenontricyclic antidepressant drughenri rene albert guy de maupassantdryopteris thelypteris pubescensbasic point defense missile systemfixed-point representation systemdisseminated lupus erythematosus
...View all with 30 letters...
Phrases (1)
respiratory distress syndrome of the newborn
