Words Containing: P,T,E,R,Y,L,A
(In Any Order)
There are 847 words,
1,096 phrases and
0 abbr's with
P,T,E,R,Y,L,A in.
Best Scoring Words With: P,T,E,R,Y,L,A
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
pyrolyzate | 10 | 27 | verb, nounv, n | |||||
Valid word for Scrabble US
| ||||||||
phylactery | 10 | 23 | nounn | |||||
noun • (Judaism) either of two small leather cases containing texts from the Hebrew Scriptures (known collectively as tefillin); traditionally worn (on the forehead and the left arm) by Jewish men during morning prayer | ||||||||
hypaethral | 10 | 21 | adjectiveadj | |||||
adjective satellite • partly or entirely open to the sky | ||||||||
archetypal | 10 | 20 | adjectiveadj | |||||
adjective satellite • representing or constituting an original type after which other similar things are patterned | ||||||||
hypethral | 9 | 20 | adjectiveadj | |||||
adjective satellite • partly or entirely open to the sky | ||||||||
telegraphy | 10 | 19 | nounn | |||||
noun • communicating at a distance by electric transmission over wire • apparatus used to communicate at a distance over a wire (usually in Morse code) | ||||||||
pyrolysate | 10 | 18 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
hyperalert | 10 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
polywaters | 10 | 18 | nounn | |||||
Valid word for Scrabble US
| ||||||||
apparently | 10 | 17 | adverbadv | |||||
adverb • from appearances alone • unmistakably (`plain' is often used informally for `plainly') | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (44)
apparentlyrepeatedlyseparatelyarchetypalpleasantrytelegraphytemporallydepilatoryepistolaryhypaethralphylacterymalapertlypaternallypyrolysatepyrolyzateparentallyprenatallyinterplayshyperalertpersonaltypolywaterspregnantlyspectrallypectorallypenetrablycalyptratepternohylaapterygialtaperinglypermutablycaprylatesstrokeplayplatelayertelpherwayplanimetry
...View all with 10 letters...
Phrases (7)
dart playertriple playparty linertape playerstroke playkoto playerliberty capWords (83)
personalitydesperatelytemporarilypermanentlyprematurelypterodactylperpetuallyexplanatoryexploratorypredictablypeculiaritythermopylaeexculpatoryrespectablylycanthropecounterplaypresentablycorporatelyoperativelyrepentantlytemperatelyplatyrrhineproximatelyrepugnantlyexplicatoryexemplarityacropetallyoperabilityprevalentlypolarimetryhypothermaltetraploidyphalansteryinterplayeddisparately
...View all with 11 letters...
Phrases (18)
flute playerpearl oystercrape myrtlemystery playoyster plantpanther lilypanty girdlesunray pleatplain turkeysitar player
...View all with 11 letters...
Words (82)
pejorativelypolyurethanearchetypallypermeabilityimperativelyarchetypicalephemeralitycorporealityprofligatelyinterplayingtetrapyrroleprudentiallypresbyterialhypermutableimpenetrablyextemporallypreovulatoryplebiscitarypolysorbatesdrapeabilitypyrocatecholproteoglycandisreputablysuperqualitydiscrepantlyparenterallyseparabilitychalcopyritehyperplasticinapparentlyentropicallyreputabilityhyperrealistcounterplayspremaritally
...View all with 12 letters...
Phrases (28)
real propertytennis playerpetit larcenyliberal partyguitar playercentury plantprotea familystone parsleyportal systempeople's party
...View all with 12 letters...
Words (154)
approximatelyappropriatelycomplimentaryparliamentarypredominantlyspectacularlycomparativelycomplementarysupplementarystereotypicalprovocativelypredominatelypolycarbonatetransparentlysuperlativelyunrepentantlypropheticallyprecipitatelyunpredictablyhypercriticalamitriptylinepenetratinglypenetrabilityintemperatelyperishabilityspreadabilityphosphorylatehyperinflatedtetrapyrrolesrepairabilitysuperloyalistdeprecatinglydeprecatorilypreparatorilyrepeatability
...View all with 13 letters...
Phrases (34)
battle of ypresheavy particlelatency periodtravel rapidlyfamily therapyatopic allergyreptile familyherbal therapypaul mccartneyfree soil party
...View all with 13 letters...
Words (132)
metaphoricallyrespectabilityinterplanetaryelectrotherapyhyperventilatepredictabilitysupernaturallyexperimentallyappreciativelysuperficialityphosphorylatedpolymerizationprovidentiallyorthopedicallyplethysmographdepartmentallyarchetypicallyneuropathologypreferentiallypraiseworthilyimpermeabilitypreponderantlyimpregnabilityphosphorylatespleasurabilitysuperloyalistsupgradeabilityparametricallypresentabilityhyperrealisticpreponderatelyphytoplanktersexasperatinglyperformabilitypertinaciously
...View all with 14 letters...
Phrases (45)
tubal pregnancyvisual propertycitellus parryipan troglodytesliterary periodtrombone playerpolychaete wormfootball playeritalian cypresspudendal artery
...View all with 14 letters...
Words (122)
inappropriatelyparentheticallyplenipotentiaryproportionatelytherapeuticallyuncomplimentarypostoperativelyunparliamentarypolyunsaturatedtemperamentallyimperishabilitycomplementarityimponderabilityautotetraploidyhypersalivationperipateticallysuperplasticityhyperstimulatedhyperstimulateshydroxylapatiteuncopyrightablesuperabundantlypolymerisationspolycrystallinehyperfunctionalproselytizationneuropathicallytelegraphicallypyrotechnicallyphosphorylativeinterpersonallyirrepealabilityhyperinflationsreduplicativelyphotometrically
...View all with 15 letters...
Phrases (64)
alimentary pastestonecrop familycomplex body partbrittany spanielbuttercup familycapital of turkeypersonality testcapillary arteryspatial propertytactile property
...View all with 15 letters...
Words (69)
triphenylmethaneunpredictabilityhyperventilationelectromyographypharmaceuticallyextemporaneouslyhypersalivationsextracorporeallyparamagneticallyhypersexualitiesthermoplasticityhyperstimulatinghyperstimulationhyperventilatingperpendicularitymorphometricallylyginopteridalesstenographicallystereophonicallyperiphrasticallystereoscopicallyprotoarchaeologyimperturbabilitypetrographicallyunrespectabilityhypercellularitytransplacentallyphenylketonuriasorganolepticallyprerevolutionaryphosphoglyceratehysterocatalepsyrepresentativelyelectromyographsinappreciatively
...View all with 16 letters...
Phrases (68)
strictly speakingcapital of new yorkpharyngeal tonsilpolitical libertyprince albert's yewspectrum analysispersonal propertybetula papyriferacortical epilepsyexternal body part
...View all with 16 letters...
Words (53)
contemporaneouslyinterdisciplinaryhyperstimulationsspectroscopicallyhyperventilationspaternalisticallymorphogeneticallycryptocrystallinecrystallographerspentylenetetrazolcrystallographiespostrevolutionarymicropaleontologydisrespectabilityhyperalimentationnephelometricallyptilonorhynchidaeimperialisticallytriphenylmethanesjurisprudentiallyphosphoglycerateselectromyographicimpressionabilityultracontemporaryamphitheatricallycopolymerizationsretroperitoneallyheterotrophicallydephosphorylatingdephosphorylationdepolymerizationschemoprophylacticpalaeoethnographyphotoperiodicallyentrepreneurially
...View all with 17 letters...
Phrases (90)
mary leontyne pricepearly everlastingcylinder separatorpython reticulatusolfactory propertycontemporary worldcult of personalitypopularity contestjoseph deems taylorfamily phthiriidae
...View all with 17 letters...
Words (26)
disproportionatelyhypercoagulabilityhyperaldosteronismpolyesterificationspectroheliographypentylenetetrazolsstereospecificallyhypercholesteremiamyeloproliferativegranulocytopoiesesspectrographicallygranulocytopoiesisrepresentationallyelectromyographiesmetallographicallyelectrooculographyelectrophotographydephosphorylationspalaeoanthropologyoveroptimisticallyhyperalimentationsdimethyltryptaminehypernationalisticpolyacrylonitrileshyperpolarizationshyperrationalitiesPhrases (108)
revolutionary groupfamily physeteridaeinfantile paralysiscapital of new jerseytypographical errorpolish monetary unitrespiratory illnessphoenix dactyliferaparliamentary agentelectronics company
...View all with 18 letters...
Words (22)
cinematographicallypolyesterificationshypolipoproteinemiaparthenogeneticallybacteriochlorophyllphenylthiocarbamidephosphoenolpyruvateinterdepartmentallyhysterosalpingogramimpressionisticallyelectrophoreticallyanthropocentricallyelectroretinographyoverproportionatelyphytogeographicallyhyperemotionalitiesdimethyltryptamineshyperexcitabilitiescytophotometricallyhyperirritabilitiesexpressionisticallyelectrocardiographyPhrases (108)
water-plantain familyfamily cyclopteridaealpine type of glacierphytolacca americanafamily dasyproctidaefamily tropaeolaceaehydrobates pelagicussubfamily potoroinaeprobability theoristgenus arctostaphylos
...View all with 19 letters...
Words (15)
hypercholesterolemialymphogranulomatosesbacteriochlorophyllsphenylthiocarbamidesoophorosalpingectomyphosphoenolpyruvatesneuropsychiatricallyhyperlipoproteinemiaelectrophysiologicalroentgenographicallyencephalomyocarditischemotherapeuticallymicrophotometricallyhypercoagulabilitiesplethysmographicallyPhrases (99)
balaenoptera physalusfamily trachipteridaefriendly relationshipclosure by compartmentamyloid protein plaquepolitically incorrectglycerol tripalmitatesupplementary benefithyperoodon ampullatusphylogenetic relation
...View all with 20 letters...
Words (4)
stereomicroscopicallyelectromyographicallyhypercholesterolemiaspsychotherapeuticallyPhrases (91)
eucalyptus fraxinoidesisle royal national parkspectroscopic analysissuperfamily tyrannidaeorder lyginopteridalesphysiological propertyclustered lady's slipperperomyscus maniculatusfamily cyprinodontidaephytelephas macrocarpa
...View all with 21 letters...
Words (5)
pentamethylenetetrazolspectrophotometricallyelectroencephalographyelectrophysiologicallyencephalomyocarditisesPhrases (76)
haliaeetus leucorhyphusredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathysodium tripolyphosphateathyrium thelypteroidesmale reproductive systematmospheric electricityparliamentary proceduresamuel pierpoint langley
...View all with 22 letters...
Words (2)
polytetrafluoroethylenehypobetalipoproteinemiaPhrases (54)
posterior pituitary glandyellowstone national parkdorothy rothschild parkersciadopitys verticillatatricyclic antidepressanteastern malayo-polynesianamerican federalist partyartocarpus heterophylluswestern malayo-polynesianminister plenipotentiary
...View all with 23 letters...
Words (3)
hyperbetalipoproteinemiaelectrocardiographicallymicroelectrophoreticallyPhrases (36)
subphylum cephalochordataprivately held corporationanal retentive personalityoxidative phosphorylationelectroconvulsive therapypelecanus erythrorhynchossuperior cerebellar arteryposterior meningeal arteryprofessional tennis playerperfectly inelastic demand
...View all with 24 letters...
Words (1)
immunoelectrophoreticallyPhrases (26)
polystichum acrostichoidesmelanerpes erythrocephaluscaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkinhormone-replacement therapyspecial theory of relativitycomplementary distributionsuperorder labyrinthodontapelvic inflammatory disease
...View all with 25 letters...
Phrases (28)
employee stock ownership planbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authoritysystemic lupus erythematosusscardinius erythrophthalmussuperorder labyrinthodontianontricyclic antidepressantintermediate temporal artery
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (22)
augustus welby northmore puginco-operative republic of guyanatricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteintopical prostaglandin eyedropprimary sexual characteristicreciprocal-inhibition therapyhypothalamic releasing factor
...View all with 27 letters...
Phrases (15)
revolutionary people's strugglecardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armyrevolutionary proletarian armysmall computer system interfacepalestinian national authorityhypothalamic releasing hormoneeucalyptus maculata citriodorapan troglodytes schweinfurthii
...View all with 28 letters...
Phrases (14)
antisocial personality disorderinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonultrasonic pulse velocity testertheory of punctuated equilibriumanonymous file transfer protocolpressure-feed lubricating systemenvironmental protection agency
...View all with 29 letters...
Phrases (16)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencedepository financial institutionbalance of international paymentspolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalifornia personality inventory
...View all with 30 letters...
Phrases (8)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economyphysiological jaundice of the newbornPhrases (1)
socialist people's libyan arab jamahiriya