Words Containing: P,S,Y
(In Any Order)
There are 7,274 words,
3,170 phrases and
0 abbr's with
P,S,Y in.
Best Scoring
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
asphyxy | 7 | 25 | nounn | |||||
Valid word for Scrabble US
| ||||||||
zephyrs | 7 | 24 | nounn | |||||
noun • (Greek mythology) the Greek god of the west wind • a slight wind (usually refreshing) | ||||||||
pixyish | 7 | 22 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
pyjamas | 7 | 21 | nounn | |||||
noun • a pair of loose trousers tied by a drawstring around the waist; worn by men and women in some Asian countries • (usually plural) loose-fitting nightclothes worn for sleeping or lounging; have a jacket top and trousers | ||||||||
sphynx | 6 | 21 | nounn | |||||
noun • Alternative form of Sphynx | ||||||||
joypops | 7 | 21 | nounn | |||||
Valid word for Scrabble US
| ||||||||
pyxides | 7 | 20 | nounn | |||||
noun • A small box • A capsule in which the lid separates from the top of the fruit to release the seeds; a pyxidium • A nautical compass • The box in which ashes are stored for Ash Wednesday • Acetabulum | ||||||||
psychic | 7 | 19 | nounn | |||||
noun • a person apparently sensitive to things beyond the natural range of perception adjective satellite • affecting or influenced by the human mind • outside the sphere of physical science | ||||||||
skyphos | 7 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
jaspery | 7 | 19 | verbv | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
spyWords (333)
physicspsychicdisplayautopsysharplyolympuscyclopssymptompyjamaspresleyspecifycalypsoleprosyparsleysynapsesparklycypresspapyrusscrappypyrrhussyncopeshapelydempseygossipypaisleyshrimpyspindlyspringystroppystupefydyspneasplashyspasskypasskeyspyware
...View all with 7 letters...
Phrases (7)
stay putpsych uppay casht. f. powysgussy upsick payshop boyWords (514)
possiblyphysicalsympathyolympicsslipperypussycatsyphilissymphonyhypnosisepilepsysprayingladyshipplatypusshipyardphysiquesimplifystupidlytapestrypriestlyspeedwaycyclopesprophesyresupplypyreneespasserbysynapticrhapsodysisyphussynopsisspyglasssuperblyasphyxiaflyspeckplaylistparalyse
...View all with 8 letters...
Phrases (25)
type slugsea nymphswamp bayplay listgypsy cabtidy tipssea poppyslip awaysoft copysea spray
...View all with 8 letters...
Words (727)
preciselyspeciallyspecialtypsychoticstupidityphysicianraspberryblasphemypresentlyphysicisthypocrisyspeakeasypsychosisparalysisdisplayedpurposelyparalysedsupplyingpantyhoseposteritypseudonymsupremacyplayhousesymposiumexpresslyemphysemahypnotistpolyesterswordplayprofuselyhypnotismhairspraysupremelypolynesiahorseplay
...View all with 9 letters...
Phrases (55)
shy personheavy sparparty bossgenus nypaadp systemfine sprayspeech dayarmy corpsposter boypaul heyse
...View all with 9 letters...
Words (993)
especiallypersonallyphilosophyphysicallyconspiracypreviouslypsychologysupposedlyscreenplaypsychopathprosperityseparatelypositivelyapocalypsehypothesispresidencypresumablysimplicityhopelesslycompulsoryhyperspacespecialitysympathizepsychiatrystereotypesleepyheadphysiologypleasantlyexpresswayskyscrapercyberspaceupholsterypassagewayhelplesslypythagoras
...View all with 10 letters...
Phrases (78)
epoxy resinfield pansyparis daisypastry cooksugar syrupspanish flygenus physaexpress joyhouse partybeauty spot
...View all with 10 letters...
Words (1053)
possibilitypersonalitydesperatelypsychiatrichospitalitysympatheticsuperiorityrespiratoryspirituallypsychedelicspontaneitypromiscuitydiscrepancycolonoscopyresponsiblymetaphysicspyroclasticlaparoscopyhorseplayerserendipitysupervisoryimpulsivelybathysphereunspeakablysuppositorysymptomaticpolystyrenehypospadiashydroponicsasphyxiatedplayfulnesssympathizersphericallypersnicketysimplifying
...View all with 11 letters...
Phrases (119)
body processgypsum boardspiny pufferspecial jurypussy willowbald cypressparty spiritcypress vineanise hyssopgenus ophrys
...View all with 11 letters...
Words (986)
psychiatristspecificallypsychologistsurprisinglypennsylvaniadisciplinaryrespectfullypassionatelyspiritualitymetaphysicalpsychopathicasphyxiationsuspiciouslytransparencyhypertensionhypothalamusrespectivelyposthypnoticpresbyterianpersistentlyastrophysicspolysyllabicpurposefullyhypertensivepyrotechnicspsychobabblecompulsivelypsychotropicegyptologistpraiseworthyprecariouslypsychosocialcompensatorypsychoactiveimpressively
...View all with 12 letters...
Phrases (151)
backspace keystaying powerlickety splitshaking palsyphantasy lifebarbary sheepanas clypeatagenus apteryxgenus cyperustennis player
...View all with 12 letters...
Words (816)
psychologicalspontaneouslyimpossibilitypsychoanalystprogressivelyhieroglyphicsphysiologicalpsychosomaticpsychotherapyphysiotherapyspectacularlysupplementaryhyperhidrosisstereotypicalpainstakinglyirresponsiblysuperficiallypsychosurgeryunsympatheticconspicuouslypsychoanalyzeneurosyphilissympathectomyantipsychoticprovisionallyhydrocephalusdisparaginglyprostatectomypicturesquelystaphylococcitransparentlyinexpensivelypennsylvanianexpeditiouslypsychophysics
...View all with 13 letters...
Phrases (196)
spiny anteaterholy sepulcherholy sepulchretaste propertygenus bradypusgenus gypaetusbattle of ypresjapanese deitygenus cyprinusgenus nymphaea
...View all with 13 letters...
Words (635)
responsibilityprofessionallypsychoanalysisrespectabilityhypersensitivephotosynthesisastrophysicistparapsychologypsychoanalyticcontemptuouslypsychoneuroticsupernaturallysusceptibilitymetaphysicallymetempsychosispsychodynamicsstaphylococcusoptimisticallysuperficialitychlorophyllousphosphorylatedsimplisticallyhypothyroidismpyelonephritisplethysmographpsychoneurosisphotosyntheticunsuspectinglyhydrotherapiststaphylococcaldisapprovinglypreposterouslyhistoriographypraiseworthilypachydermatous
...View all with 14 letters...
Phrases (214)
class scyphozoagenus gossypiumvisual propertysymphonic musiclacrosse playergenus gymnogypschinese parsleycalypso bulbosadizzy gillespiemost especially
...View all with 14 letters...
Words (416)
psychologicallypsychotherapistphysiologicallydisrespectfullyphilosophicallyphysiotherapistsympathomimeticoversimplifyingsurreptitiouslypsychobiologistsuppositionallymicroscopicallydisappointinglyinconspicuouslyneurophysiologycompassionatelyphotosynthesizepostoperativelyintrospectivelypolyunsaturatedinspirationallycrystallographypsychopathologysympatheticallydispassionatelycorrespondinglyretrospectivelyeuphemisticallyneuropsychiatrypessimisticallypsychiatricallycomprehensivelyultrasonographyimperishabilityadenohypophysis
...View all with 15 letters...
Phrases (275)
class pelecypodaalimentary pasteebony spleenwortmrs. humphrey wardorycteropus aferpsychotic beliefstonecrop familyspiny-headed wormscholarly persongempylus serpens
...View all with 15 letters...
Words (208)
irresponsibilityincomprehensiblycatastrophicallypsychoanalyticaluncompromisinglypsychophysiologysphygmomanometerextemporaneouslypsychobiologicalhypersensitivityunprofessionallyparapsychologistneuropsychiatricpolydispersitieshypersalivationspolyelectrolytesantistrophicallyspondylarthritishypersensitizinghypersexualitieshypersomnolencesthermoplasticityhyperstimulatingparaphrasticallyhyperstimulationparapsychologiespolysynapticallypositivisticallyhypersusceptibleparasympatheticsapocryphalnesseshyperthyroidismshyperviscositieshypervitaminosesmalayo-polynesian
...View all with 16 letters...
Phrases (263)
strictly speakinggenus crotaphytushypophyseal stalkpodocarpus familywoolly plant louseexemplary damagescalystegia sepiumprotoctist familygenus aptenodytesnervus hypoglosus
...View all with 16 letters...
Words (112)
superconductivitycardiorespiratoryneurophysiologistcontemporaneouslypsycholinguisticspsychotherapeuticmultidisciplinaryprobabilisticallyinterdisciplinaryhyperreactivitiesphysiotherapeuticparaformaldehydeskaleidoscopicallyspondylolisthesisradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectrophotometryspectroscopicallyhyperventilationsnonprofessionallysphygmomanometershypnotizabilitiesthrombocytopeniaspaternalisticallyhypophysectomizespathophysiologieshyposensitizationhypophysectomisedhypophysectomizedcryopreservationscryptocrystallineencephalomyelitiscrystallographers
...View all with 17 letters...
Phrases (316)
gopherus polypemusdivision bryophytasalvia leucophyllapearly everlastingclass rhodophyceaefamily dasypodidaelycopus americanussubphylum craniatagenus symphalangusantipsychotic drug
...View all with 17 letters...
Words (77)
disproportionatelypsychopharmacologypsychopathologicalhyperaldosteronismsociopsychologicalneuropsychologicalhypersensitivenesspolyesterificationspectrofluorometryhypersensitivitieshypersensitizationpolymorphonuclearsspectroheliographynoncomprehensivelypsychotherapeuticssphygmomanometrieshypoparathyroidismhypophysectomizingpathophysiologicalhyposensitizationspentylenetetrazolslaryngopharyngitisperchloroethyleneslipopolysaccharidepostpsychoanalytictriphosphopyridinelymphangiographiesstereospecificallypteridospermaphytamucopolysaccharidehypercholesteremiasubmicroscopicallyorthopsychiatristsoscillographicallygranulocytopoieses
...View all with 18 letters...
Phrases (280)
worldly possessionsdivision anthophytafamily physeteridaefreudian psychologyperomyscus leucopusposterior pituitarypodilymbus podicepskilocycle per secondsuperiority complexfamily asparagaceae
...View all with 18 letters...
Words (40)
hyperparathyroidismpsychophysiologicalpolyesterificationshypersensitizationspolyribonucleotideshypersusceptibilityparathyroidectomieshypoparathyroidismsmucopolysaccharideslipopolysaccharidesconceptualisticallycytopathogenicitiesphenomenalisticallyphosphatidylcholinephosphoenolpyruvatehysterosalpingogramimpressionisticallymethylprednisoloneselectrophysiologieselectrophysiologistincomprehensibilityencephalomyelitideshistopathologicallyhistoriographicallydihydrostreptomycinparasympathomimeticpsychopharmacologicsymptomatologicallyphytohemagglutininshyperconcentrationspsychophysiologistshypoadrenocorticismpsychotomimeticallyhyperemotionalitiesdimethyltryptamines
...View all with 19 letters...
Phrases (246)
building supply houseclass polyplacophorafamily lepisosteidaefamily dasyproctidaedivision schizophytagenus cryptobranchusgenus symphoricarposcapital of kyrgyzstanavogadro's hypothesissalicylate poisoning
...View all with 19 letters...
Words (31)
hypercholesterolemiahypersensitivenesseslipochondrodystrophycrystallographicallyhyperadrenocorticismlymphogranulomatoseslymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesoophorosalpingectomyphosphatidylcholinesphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhistoincompatibilityultramicroscopicallyelectrophysiologicalelectrophysiologistsencephalomyocarditisphotophosphorylationpseudoparenchymatouspsychopathologicallypsychopharmacologiespsychopharmacologisthypercholesterolemichypercoagulabilitiespalatopharyngoplastyhyperconsciousnessesplethysmographicallyhyperparathyroidismsPhrases (197)
wyethia amplexicaulisbalaenoptera physalusdivision tracheophytadianthus caryophyllusfamily pseudococcidaeeucalyptus calophyllalophodytes cucullatusfriendly relationshipjapanese monetary unitclosure by compartment
...View all with 20 letters...
Words (10)
psychopharmacologicalhypersusceptibilitiesstereomicroscopicallymucopolysaccharidosisphosphoglyceraldehydephotophosphorylationshypercholesterolemiaspsychopharmacologistspsychophysiologicallypsychotherapeuticallyPhrases (164)
pseudemys rubriventriseucalyptus fraxinoidesisle royal national parkcapital of pennsylvaniaparty to the transactioncucurbita argyrospermaarctostaphylos uva-ursiptolemy ii philadelphusspectroscopic analysisspeech intelligibility
...View all with 21 letters...
Words (6)
spectrophotometricallyintercomprehensibilityphosphoglyceraldehydeselectrophysiologicallyencephalomyocarditisesmicrospectrophotometryPhrases (136)
lycopersicon esculentumhaliaeetus leucorhyphussodium tripolyphosphatehigh-density lipoproteinathyrium thelypteroidesmale reproductive systematmospheric electricitysphyrapicus varius ruberjohns hopkins universitynyctereutes procyonides
...View all with 22 letters...
Words (1)
phosphatidylethanolaminePhrases (76)
argyroxiphium sandwicensedivision heterokontophytasubphylum cephalochordataprimary sex characteristicapocynum androsaemifoliumexistentialist philosophyhypersensitivity reactionchrysosplenium americanumanal retentive personalityoxidative phosphorylation
...View all with 24 letters...
Words (2)
phosphatidylethanolaminesuvulopalatopharyngoplastyPhrases (53)
myroxylon balsamum pereiraesymphoricarpos orbiculatusmodest petrovich mussorgskypolystichum acrostichoidesmelanerpes erythrocephaluscaulophyllum thalictroidestrans-alaska pipeline systemmichelson-morley experimentsuborder petromyzoniformesconstant of proportionality
...View all with 25 letters...
Phrases (45)
employee stock ownership plansubdivision coniferophytinabureau of diplomatic securitybenign prostatic hyperplasiapalestine national authoritysystemic lupus erythematosuscalycophyllum candidissimumscardinius erythrophthalmussuperorder labyrinthodontialeptodactylus pentadactylus
...View all with 26 letters...
Phrases (33)
aleksandr sergeyevich pushkinaugustus welby northmore puginpull the wool over someone's eyesdeoxyadenosine monophosphatetricyclic antidepressant drugdeoxythymidine monophosphatethyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtensteinstationary stochastic process
...View all with 27 letters...
Phrases (25)
revolutionary people's struggleephippiorhynchus senegalensistriphosphopyridine nucleotidecardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitydissident irish republican armysmall computer system interfacesingle nucleotide polymorphismimperial japanese morning glory
...View all with 28 letters...
Phrases (14)
antisocial personality disorderdisorganized type schizophreniaautomatic data processing systemsao thome e principe monetary unitmiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonultrasonic pulse velocity testeranonymous file transfer protocolpressure-feed lubricating system
...View all with 29 letters...
Phrases (20)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepository financial institutionbalance of international paymentssevere acute respiratory syndromecalifornia personality inventorymucocutaneous lymph node syndromenontricyclic antidepressant drug
...View all with 30 letters...
Phrases (9)
great smoky mountains national park2019-ncov acute respiratory diseaserevolutionary proletarian nucleusport-access coronary bypass surgeryprimary subtractive color for lightfibrocystic disease of the pancreasmarine corps intelligence activityhuygens' principle of superpositionfrequency-response characteristicPhrases (9)
weakly interacting massive particlecercopithecus aethiops pygerythrusprimary subtractive colour for lightoculopharyngeal muscular dystrophylymphocytic choriomeningitis virusprogressive emphysematous necrosischrysanthemum coronarium spatiosumadult respiratory distress syndromecystic fibrosis transport regulatorPhrases (10)
autonomous sensory meridian responselycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by juryfloating-point representation systempositron emission tomography scannersubacute inclusion body encephalitisamaranthus hybridus hypochondriacusphysiological jaundice of the newbornPhrases (9)
first epistle of paul the apostle to timothyuniversity of north carolina at chapel hillattention deficit hyperactivity disordergenerally accepted accounting principlestrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentacademy of motion picture arts and sciencesdefense advanced research projects agencysixteen personality factor questionnairePhrases (1)
respiratory distress syndrome of the newborn