Words Containing: P,R,E,D,I,V,E,_
(In Any Order)
There are 219 words,
359 phrases and
0 abbr's with
P,R,E,D,I,V,E,_ in.
Best Scoring Words With: P,R,E,D,I,V,E,_
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
pulverized | 10 | 25 | verb, adjectivev, adj | |||||
adjective satellite • consisting of fine particles | ||||||||
overprized | 10 | 25 | adjectiveadj | |||||
verb • To prize excessively; to overvalue. | ||||||||
apperceived | 11 | 21 | verbv | |||||
verb • perceive in terms of a past experience | ||||||||
predelivery | 11 | 20 | noun, adjectiven, adj | |||||
Valid word for Scrabble US
| ||||||||
descriptive | 11 | 19 | adjectiveadj | |||||
adjective • serving to describe or inform or characterized by description • of or relating to an approach to linguistic analysis that aims at the description of a language's forms, structures and usage | ||||||||
unperceived | 11 | 19 | adjectiveadj | |||||
adjective satellite • not perceived or commented on | ||||||||
overslipped | 11 | 19 | ||||||
Valid word for Scrabble US
| ||||||||
livetrapped | 11 | 19 | verbv | |||||
Valid word for Scrabble US
| ||||||||
slipcovered | 11 | 19 | verb, adjectivev, adj | |||||
Valid word for Scrabble US
| ||||||||
preadaptive | 11 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (38)
descriptiveoverpraisedunperceivedoverspilledprevisioneddepravitiesapperceivedvituperatedoverslippedlivetrappedoverprintedslipcovereddepressivespredeliveryprivateeredpreadaptivepremedievaloverplaidedprovidencespredicativediscerptivedeprecativedispurveyedoverripenedunreprievedrepudiativedeprivativedeprivementoverpaintedpower-drivenperfervidlydepurativesvelocipederproveditoreoverpitched
...View all with 11 letters...
Phrases (4)
privet hedgehorned viperspider nevuspee dee riverWords (40)
reproductiveimpoverishedunsupervisedpreconceivedoverspendingredevelopingunprivilegedvideographerreprivatizedoverpromisedprerogativeddepreciativemisperceiveddepressivelydispersivelyoversuppliedoverpedalingpredictivelyprediscoveryimprovidenceoverequippedpostdeliveryprevaricatedempoverisheddeprivementslavender-pinksuperevidentpink-lavenderperfervidityovercanopiedunpredictiveoverpicturedvelocipedersproveditoresprovendering
...View all with 12 letters...
Phrases (5)
typhoid feverpelvic girdlednieper riverdeep-sea diverdiving petrelWords (31)
eavesdroppingoverexpandingoverexplainedreproductivesreprovisionedvideographerspremeditativeoverexploitedoverspreadingreduplicativeoverimpressedvideographiesoverpedallingnondispersivedescriptivelypredicativelyoveramplifiedimprovidencesdeprecativelydispurveyanceprejudicativepredeliveriesundescriptiveunperceivedlyperfervidnesspredevelopingimpredicativedecompressivedisprivilegeddisprivilegesprickly-leavedPhrases (10)
periodic eventgiuseppe verdivice presidentcovered optioninverted pleatrelative speedstriped violetspike lavenderprinter's devilpreemptive bidWords (31)
oversimplifiedreproductivelyoveremphasizedpreintervieweddisruptivenesspredevaluationoverpersuadinghypercivilizedoverprescribedoverprivilegedsupercivilizedoverrespondingoverdevelopingdispersivenessnondescriptiveprediscoveriesproductivenessdispurveyancessupercivilisedovermultipliedbrevicipitidaevespertilioniddepressivenesseavesdroppingspredestinativeperferviditiesproverbialisedhypercivilisedproverbializedoveremphasisedvice-presidencyPhrases (16)
imperative mooddurative aspectadverse opinionkilldeer ploverspecial verdictdevil worshiperadoptive parentdevonian periodovertime periodpositive adverb
...View all with 14 letters...
Words (20)
underprivilegedoverspecializeddescriptivenessovercomplicatednonreproductivereduplicativelysuperconductiveoveropinionatedovercapitalizedhyperventilatedradioprotectivepostdivestitureunderdevelopingvespertilionidspredevaluationsperfervidnessespinkish-lavenderovercapitalisedmanic-depressiveoverspecialisedPhrases (12)
president hooveradhesive plasterspecial deliveryprivet andromedaasplenium viridepericardial veinline-drive triplefamily viperidaepope alexander viforceps delivery
...View all with 15 letters...
Words (8)
dispersivenessesdisruptivenessesvespertilionidaeinward-developingproductivenessesunproductivenessoverproportionedvice-presidentialPhrases (23)
private detectiveperiodic movementprojective deviceperipheral devicevena pericardiacapreconceived ideaappendicular veinorb-weaving spiderpre-valentines daydeep cervical vein
...View all with 16 letters...
Words (5)
counterproductivenonproductivenessoutward-developingdescriptivenessesoversophisticatedPhrases (33)
footprint evidenceverbal descriptioncompromise verdictcolorado river hempdependent variablepartial derivativedeveloping countrypresident van burensuperlative degreemild silver protein
...View all with 17 letters...
Words (1)
polyvinyl-formaldehydePhrases (27)
republic of cote d'ivoirepeter alexander ustinovmale reproductive glandellipsoid of revolutionlope felix de vega carpiopseudemys rubriventrisimmunosuppressive drugcape verde monetary unitus trade representativeposterior cardinal vein
...View all with 21 letters...
Phrases (18)
pelham grenville wodehousedivision heterokontophytaprivately held corporationspiral ratchet screwdriverpleading in the alternativefemale reproductive systemregistered representativedryopteris noveboracensisfederal protective servicehuman reproductive cloning
...View all with 24 letters...
Phrases (16)
count ferdinand von zeppelinboris leonidovich pasternakmodest petrovich mussorgskycommand processing overheadunited states postal servicelepidocybium flavobrunneumcanadian maritime provincespodkamennaya tunguska riververy low density lipoproteinpelvic inflammatory disease
...View all with 25 letters...
Phrases (12)
male internal reproductive organgiovanni pierluigi da palestrinareceived pronunciation languagekatmai national park and preservetheodore roosevelt national parkexecutive office of the presidentelectronic simulative deceptiongrigori aleksandrovich potemkinsimulative electronic deceptiondenali national park and preserve
...View all with 29 letters...
Phrases (1)
lake clark national park and preservePhrases (1)
russian soviet federative socialist republic