Words Containing: P,I,G,F
(In Any Order)
There are 396 words,
640 phrases and
0 abbr's with
P,I,G,F in.
Best Scoring Words With: P,I,G,F
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| puffing | 7 | 16 | verbv | |||||
noun • blowing tobacco smoke out into the air • an act of forcible exhalation | ||||||||
| pigfish | 7 | 16 | nounn | |||||
noun • found around the Great Barrier Reef • found from Long Island southward | ||||||||
| fopping | 7 | 15 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| pfennig | 7 | 13 | nounn | |||||
noun • 100 pfennigs formerly equaled 1 Deutsche Mark in Germany | ||||||||
| upfling | 7 | 13 | verbv | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Phrases (1)
fig upWords (34)
flippingflappingflagshipfloppingproofinggiftwrappifflingspiffingfireplugpettifogprefightpurflinggigaflopspoofingupflingsfrappingflumpingpiaffingpfennigepfennigscaprifigfoplingsgiftshoppigfacespigfeedsfrumpingpuffingsflimpingperfingspouffingpluffingpinguefypfenninggift-wrapPhrases (2)
pigs' feetgift shopWords (52)
offspringprofilingupliftingpurifyingfingertippacifyingpreflightpilferagetopflightperfusingprofaningprefiguregiftwrapsupflowingprefacingflagshipsprefixingpanfryingtypifyingperfumingpilferingprofitinggigaflopstepefyingupfoldingpigfishesprefadingcaprifigsprefilingprefiringpurflingspettifogsfillipingspiffyingupwafting
...View all with 9 letters...
Phrases (2)
firing pinfrying panWords (60)
performinggrapefruitprofligacypreferringspecifyingprofessingamplifyingprizefightpersiflagefrangipaniprofligatestupefyingpetrifyingputrefyinghippogrifflightprooffingerpostupflingingpostflightsprightfulprefabbingupshiftingfingertipsprefiguredprefiguresperfectingpilferagespresiftingoffspringsprofferingprofilingspostfixingfrangipanefingerpickyuppifying
...View all with 10 letters...
Phrases (11)
flight pathprize fightpigeon loftfringe cupsangle of dipspring frogcalf ropingdamping offpirate flagleaf spring
...View all with 10 letters...
Words (71)
fingerprintspringfieldshopliftingsafekeepingsimplifyingfilmographyprettifyingrepacifyingprofligatesgiftwrappedgrapefruitslapidifyingprestigefulflyspeckingairproofingslipformingsaponifyingfingerpostspredefiningprefiguringpreflightedrepurifyingprefocusingparaffiningfrontpaginghippogriffsopsonifyingpersiflagesdropforgingspaceflightfrangipanespostformingfrangipannifingerpickscopurifying
...View all with 11 letters...
Phrases (21)
high profilepipe fittingflight striptapering offpair of tongsfinger platelanding flapgross profitbulgur pilaffishing pole
...View all with 11 letters...
Words (63)
fireproofingprizefighterexemplifyingpettifoggingpersonifyingleapfroggingprofligatelysportfishingprofligaciesgiftwrappingprenotifyingbabyproofingsprightfullyfingerprintspussyfootingtypefoundingpreflightingbackflippingstupefyinglyproofreadingrainproofingmothproofingpremodifyingbombproofingpresignifiesdeepfreezingrustproofingprofiteeringspeechifyingpreinformingrespecifyingflexographicfingerpickedpitchforkingsafekeepings
...View all with 12 letters...
Phrases (32)
sponge filterskiffle groupfowling piecelogical proofgift wrappingfurring stripparfait glassspiny dogfishflaming poppyplaying field
...View all with 12 letters...
Words (45)
pontificatingprizefightingsoundproofingwaterproofingprefigurationprefigurativefingerpickingfingerprintedcomplexifyingflameproofingfluorographicfluoroscopingfellowshipingoutperformingprizefighterspresignifyingproliferatingprequalifyingprespecifyingflexographiesprefigurementtypefoundingssportfishingspettifoggingspreformattingnonperformingfilmographiesparfocalizingfireproofingsprofiteeringsprecertifyingpowerliftingsprefiguratingsuffraganshippreachifyings
...View all with 13 letters...
Phrases (33)
male offspringbird of passagerite of passagepilgrim fatherpeace offeringflying reptilepiece of groundplanning framespinning frameshipping fever
...View all with 13 letters...
Words (33)
fingerprintingwaterproofingsprefabricatingphotofinishingfluorographiesfellowshippingfieldstrippingsuperinfectingsprightfulnessfingerpickingsprefigurationsprefigurementspettifoggeriespreformulatingprizefightingspresanctifyingshowerproofingself-propellingself-respectingsuffraganshipsself-supportinglufengpithecusfrontispiecingfractographiesfinger-paintingfinger-pointingfingerpointingfingerspellingfrench-speakingapterygiformessoundproofingsgoodfellowshipbulletproofingPhrases (41)
protein foldingcapital of gaboncapital of ghanacapital of nigerputting surfacekingdom of nepalgrapefruit peelpiece of writingcapital of egyptshipping office
...View all with 14 letters...
Words (15)
oversimplifyingweatherproofingphotofinishingsfingerprintingsprefigurativelyantishopliftingself-deprecatingspring-floweringshowerproofingshigh-performanceself-pollinatingperfectionatinggoodfellowshipsflemish-speakingunderperformingPhrases (45)
falco peregrinuscapital of gambiacapital of greececapital of guinearepublic of ghanaspecific gravitycapital of oregonregius professorcapital of ugandapair of virginals
...View all with 15 letters...
Words (8)
sprightfulnessesprofit-maximisingprofit-maximizingflexographicallypremanufacturingcaprimulgiformeshyperfunctioningantiprofiteeringPhrases (46)
capital of georgiaphotographic filmrepublic of angolacapital of hungaryperforming artistpresiding officerdamping off funguscapital of nigeriacapital of senegalenglish professor
...View all with 16 letters...
Words (2)
prefigurativenessesphotofluorographiesPhrases (51)
alpine type of glaciercapital of kyrgyzstanprivilege of the floorrepublic of guatemalacapital of luxembourgcapital of madagascarrepublic of the gambiaorder apterygiformescapital of washingtonagapanthus africanus
...View all with 19 letters...
Phrases (20)
professional organisationprofessional organizationtrip the light fantastic toecapture of fort ticonderogagovernment printing officefederal republic of germanyoffice of inspector generalprimary colour for pigmentsislamic group of uzbekistancorpuscular theory of light
...View all with 24 letters...
Phrases (12)
present perfect progressivegreat plains of north americaprairie white-fringed orchidprairie white-fringed orchisbattle of pittsburgh landingcardiospermum grandiflorumwire-haired pointing griffoncapital of the united kingdomfagus sylvatica atropuniceaaporocactus flagelliformis
...View all with 25 letters...
Phrases (18)
short-spurred fragrant orchidpolicing and enforcement costpersonal information managercapital of trinidad and tobagotrespass quare clausum fregitcapital of antigua and barbudaus government printing officearab states of the persian gulfrepublic of equatorial guineafriedrich gottlieb klopstock
...View all with 26 letters...
Phrases (10)
co-operative republic of guyanapositive reinforcing stimulusinformation processing systemoffice of intelligence supporthypothalamic releasing factorpeople's republic of bangladeshrepublic of trinidad and tobagoadeline virginia stephen woolffederal republic of yugoslaviaarchaeological planning framePhrases (11)
bureau of engraving and printingmicrosoft disk operating systemcapital of serbia and montenegrodemocratic republic of the congogates of the arctic national parkright to the pursuit of happinesscentral vein of suprarenal glandvena epigastrica superficialisbovine spongiform encephalitispan troglodytes schweinfurthii
...View all with 28 letters...
Phrases (1)
department of housing and urban development
