Words Containing: N,I,G,T,I,S,_,_
(In Any Order)
There are 3,911 words,
2,166 phrases and
0 abbr's with
N,I,G,T,I,S,_,_ in.
Best Scoring Words With: N,I,G,T,I,S,_,_
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
fetishizing | 11 | 27 | verb, adjectivev, adj | |||||
verb • To make the subject of (often sexual) obsession. • To make into a fetish, or magical object. | ||||||||
systemizing | 11 | 26 | verb, adjectivev, adj | |||||
verb • arrange according to a system or reduce to a system | ||||||||
rightsizing | 11 | 25 | verb, nounv, n | |||||
verb • To downsize | ||||||||
customizing | 11 | 25 | verb, nounv, n | |||||
verb • make to specifications • make according to requirements | ||||||||
fantasizing | 11 | 24 | verb, nounv, n | |||||
verb • indulge in fantasies • portray in the mind | ||||||||
justifying | 10 | 24 | verb, adjectivev, adj | |||||
verb • show to be right by providing justification or proof • (used of God) declare innocent; absolve from the penalty of sin • adjust the spaces between words | ||||||||
squintingly | 11 | 24 | adverbadv | |||||
Valid word for Scrabble US
| ||||||||
sovietizing | 11 | 24 | verb, adverb, adjectivev, adv, adj | |||||
verb • bring under Soviet control, of a country • model a country's social, political, and economic structure on the Soviet Union | ||||||||
stabilizing | 11 | 23 | verb, adverb, adjectivev, adv, adj | |||||
adjective satellite • causing to become stable | ||||||||
exsiccating | 11 | 23 | verb, adjectivev, adj | |||||
verb • lose water or moisture | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (122)
visitingstickingstinkingspittingstrikingexistingstirringwritingsshiftingtwistingsightingstiflingstingingstrivingslittingignatiuslinguiststainingskirtingnightiesstingiertailingsjingoistsiftingsgiantismstintingstripingitchingszingiestmingiestinsightsdingiestshirtingwhistingpositing
...View all with 8 letters...
Words (278)
listeningwhistlinginsultingsplittingswitchingstraininginsistingstrippinginvestingdigestionmistakingstitchinghindsightisolatingsquirtingtrimmingsenlistinginstigatehygieniststringingdisputingsquintingtraipsingingestionvaginitisbristlinggigantismskintightsinuatingfirstlingchitlingsstipplingstriplingbaptisinginstating
...View all with 9 letters...
Phrases (7)
vital signthis nightnight soilstring tieanti-g suitsewing kittimes signWords (429)
disgustingdisturbingsatisfyingextinguishspringtimetestifyinglivingstonhesitatingdiagnosticmeningitisinstallingglisteningsubmittinginsightfulinstigatedlinguisticblisteringjustifyingmisogynistgeneticistslitheringestimatingsimulatingdistancinginstigatornightstickmystifyingpersistingstrikinglylaryngitisabiogeniststinginessnightshirtappetisinginsulating
...View all with 10 letters...
Phrases (21)
genus vitisstring linegas fittingtime signaltouring skipet sittingfishing netrising tiderising trotswing shift
...View all with 10 letters...
Words (621)
interestingfascinatinginvestigateadvertisingsignificantquestioningresignationastonishingdistinguishbabysittinglegislationsightseeingstimulatingindigestionshopliftingchristeningfantasizingpositioninginsinuatingdistressingstabilizingdismantlingsingularitydesignationpainstakingassociatingdignitariesrestrictingdiagnosticsinstigatingcriticisinglinguisticsstabilisingpatronisingtantalising
...View all with 11 letters...
Phrases (51)
winning postsliding boltinput signalsailing boatliving stonethis eveningsitting bullgenus litchibait castingbiting louse
...View all with 11 letters...
Words (642)
registrationthanksgivinginvestigatorinvestigatedorganisationextinguisherextinguishedtransmittingdistributingdisintegrateenterprisingsubstitutingdisgustinglyconfiscatingwittgensteinantagonisticunsatisfyingmisogynisticdisturbinglychitterlingsillustratingconstrictingwithstandingassimilatingindigestibledisorientingstreamliningconstitutingintensifyingalmightinessevisceratingintersectingtranscribingintransigentguestimating
...View all with 12 letters...
Phrases (82)
cost of livingsign industryvestal virginfencing stickswitch enginesigrid undsetwest virginiabering straitnagari scriptscouting trip
...View all with 12 letters...
Words (599)
investigationinvestigatingdistinguisheddisappointinginsignificantinvestigativesignificantlyinterestinglyimpersonatinguninterestingdisintegratedscintillatingdisintegratordisconcertingglobalisationbrainstormingastonishinglyornithologistnecessitatingextinguishingassassinatingpainstakinglyconsolidatingdistressinglyhairsplittingdiagnosticiandiscontinuingdisseminatingrationalisingcartilaginousdisfigurementcriminologistdishearteningrepositioningintransigence
...View all with 13 letters...
Phrases (125)
measuring unitsummit meetingbritish guianain good spiritsswimming eventin high spiritsin his own rightgenus haliotisstarting pointqin shi huang ti
...View all with 13 letters...
Words (500)
distinguishingdisintegrationdiscriminatingcytogeneticistdisintegratingintelligentsiatransmigrationexsanguinationlinguisticallyprogressionistdisassociatingdisgustingnesspropagandisticreorganisationgeneralisationtransmogrifiedoverestimatingmiscalculatingtelangiectasiaintegrationistsubstantiatingtranquillisingcharacterisingtergiversationcategorisationdiagnosticallyorganisationalegalitarianismredistributingneurobiologistreinvestigatedtransmigratingunhesitatinglystigmatizationsemiconducting
...View all with 14 letters...
Phrases (167)
spring trainingmeeting of mindsigor stravinskyinterior designguardian spiritgenus nicotianagenus epipactiscognitive statestinking wattlegenus accipiter
...View all with 14 letters...
Words (411)
notwithstandingprognosticationprocrastinatingsynergisticallyoverstimulatinggastroenteritisdistinguishableundistinguisheddisappointinglydisorganizationrecrystallizingmultiprocessingreinvestigatingtransmogrifyingunquestioninglyinterrogatoriesendocrinologisttransfigurationprognosticatingprognosticativetightfistednessprestigiousnessnonintersectingsidesplittinglyimaginativenesspreregistrationstructuralizingdisambiguationscommiseratinglysedimentologistunsightlinessesinhomogeneitiesparticularisingindustrialisingindustrializing
...View all with 15 letters...
Phrases (148)
italian dressingdissolving agentswimming costumegossip columnistbritish shillinginfectious agentgenus matricariagrand inquisitortrailing arbutusmagnetic pyrites
...View all with 15 letters...
Words (109)
misunderstandinganesthesiologistgastrointestinalprestidigitationinextinguishablydisequilibratinghypersensitizingantitechnologiesinfrangibilitieshyperstimulatingmisregistrationsdisorganizationsweatherstrippingfeatherstitchingprofit-maximisingindiscriminatingdisproportioninglyginopteridalesfigurativenessesinextinguishableflagitiousnessesnonsignificantlyopisthognathidaeperiodontologiesreconfigurationstransfigurationsimmunodiagnosticintangiblenessesmultilingualismsrectangularitiesmultiprocessingsstrongyloidiasesimmunogeneticiststrongyloidiasislymphangiectasia
...View all with 16 letters...
Phrases (156)
genus utriculariaarteria vaginalisstrictly speakingneritid gastropodgenus angiopterischristian huygensgenus istiophorusperforming artistdwight eisenhowerottorino respighi
...View all with 16 letters...
Words (63)
indistinguishableneurophysiologistpsycholinguisticssuperintelligenceunmitigatednessesmisunderstandingstightfistednessescontradistinguishrecognizabilitiesantireligiousnessimaginativenessescerebromeningitisindefatigablenesstransilluminatingself-gratificationstraightjacketingmultiprogrammingsimmunogeneticistsstrongyloidosisesintelligibilitiesmagnetostrictionssubcategorizationgastroenteritidesgastroenteritisesimmunopathologiesimmunopathologistprefigurativenessreindustrializingimmunoregulationselectrodepositingdeindustrializingbloodguiltinessesinterestingnessesundistinguishableuninterestingness
...View all with 17 letters...
Phrases (189)
castilian languagelandscape paintingnikolaas tinbergeninterstate highwayantipsychotic drugaccipiter gentilistypha angustifoliamaterials handlingoriganum dictamnusplastering machine
...View all with 17 letters...
Words (52)
transmogrificationinstitutionalizingunintelligiblenessknowledgeabilitiescompartmentalisinghypophysectomizingdisproportionatinglaryngopharyngitisinstitutionalisingdistinguishabilitylacto-vegetarianismcongregationalismscongregationalistsimmunohematologiesimmunohematologistsubcategorizationsintelligiblenessesmagnetostrictivelyimmunopathologistsgeneralizabilitiestransubstantiatingorthogonalizationsgranulocytopoiesisneurophysiologistsbourgeoisificationdemythologizationsmethemoglobinemiasphotodisintegratedphotodisintegratesanagrammatizationssuperintelligenceshemoglobinopathiesinternationalisingpropagandisticallyfibrocartilaginous
...View all with 18 letters...
Phrases (193)
genus struthiomimusdrafting instrumenthindustani languagenavigational systemelaeagnus latifoliaantipsychotic agentkalmia angustifoliaaegean civilisationgarcinia mangostanasemilunar cartilage
...View all with 18 letters...
Words (29)
unintelligibilitiesextralinguisticallycrosslinguisticallyencephalomeningitiscytopathogenicitiesimmunohematologiststransmogrificationsprefigurativenessesconstitutionalizingcontradistinguishedcontradistinguishesbourgeoisificationscross-linguisticallyelectronegativitiesmeningoencephalitisphotodisintegratingphotodisintegrationultrasegregationistcounteradvertisingsovergeneralizationsindefatigablenessesoverindustrializingmicropaleontologiesmicropaleontologistantiferromagnetismslarge-capitalisationphytohemagglutininssociolinguisticallycounterinsurgenciesPhrases (159)
measuring instrumentjohn millington syngemeat-packing businesspierre-auguste renoirhandle with kid glovesorganization expensedecreasing monotonicsalicylate poisoninguniversity of chicagocost-of-living benefit
...View all with 19 letters...
Words (17)
unintelligiblenessesindistinguishabilitydistinguishabilitiesmagnetofluiddynamicsinterchangeabilitiesphiloprogenitivenessreinstitutionalizingglomerulonephritidesneuroendocrinologistdeinstitutionalizingcontradistinguishingultracentrifugationsphotodisintegrationsultrasegregationistscounterconditioningsmicropaleontologistscounterintelligencesPhrases (123)
photographic emulsionbusiness organisationbusiness organizationsecond coming of christambrose gwinett bierceaugustin eugene scribegeorges henri lemaitresingle-reed instrumentsingle-valued functionbritish pound sterling
...View all with 20 letters...
Words (6)
otorhinolaryngologistneuroendocrinologistsotorhinolaryngologiesmeningoencephalitideselectroretinographiesindistinguishablenessPhrases (149)
administrative hearingdissolution of marriagegasterosteus pungitiusanaphalis margaritaceaelaeagnus augustifoliaanigozanthus manglesiistephen william hawkingsurgical contraceptionagkistrodon contortrixstrategic intelligence
...View all with 21 letters...
Words (3)
philoprogenitivenessesotorhinolaryngologistsindistinguishabilitiesPhrases (114)
gilbert keith chestertontransient global amnesianavigational instrumenthigh-density lipoproteinmicropogonias undulatusthousand island dressingivan sergeevich turgenevarthur meier schlesingergotthold ephraim lessingsouth dravidian language
...View all with 22 letters...
Words (1)
indistinguishablenessesPhrases (81)
gilbert and ellice islandsposterior pituitary glandhippoglossus stenolepsisright of first publicationlactuca sativa longifoliakyrgyzstani monetary unitbangladeshi monetary unitgiovanni battista tiepolobowed stringed instrumenttarget acquisition system
...View all with 23 letters...
Words (1)
laryngotracheobronchitisPhrases (77)
carnegie mellon universityprofessional organisationprofessional organizationtrip the light fantastic toesir terence mervyn rattigandistinguished flying crossfrancois auguste rene rodinarthur meier schlesinger jr.gioacchino antonio rossinimagnetic resonance imaging
...View all with 24 letters...
Phrases (47)
igor fyodorovich stravinskyfrancis scott key fitzgeralddistinguished service medaledmund john millington syngesecret intelligence servicereligious society of friendsinternational organisationfood and drug administrationeigenvalue of a square matrixsir arthur stanley eddington
...View all with 25 letters...
Phrases (38)
charlotte anna perkins gilmanpolicing and enforcement costhunting and gathering societyanton grigorevich rubinsteinmalignant neoplastic diseasepersonal information managersir charles scott sherringtonstanding operating procedurebooker taliaferro washingtonjean-auguste-dominique ingres
...View all with 26 letters...
Phrases (32)
nikita sergeyevich khrushchevnuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycepositive reinforcing stimulusthyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkogaius julius caesar octavianusinformation processing system
...View all with 27 letters...
Phrases (41)
strategic arms limitation talksdistinguishing characteristicmicrosoft disk operating systemcapital of serbia and montenegroraphanus sativus longipinnatuscriminal investigation commandfederal housing administrationludwig josef johan wittgensteingrace ethel cecile rosalie allensuperconducting supercollider
...View all with 28 letters...
Phrases (16)
disorganized type schizophreniaautomatic data processing systemsouth-central dravidian languagegiovanni pierluigi da palestrinascrutin uninominal voting systemcongregational christian churchfrancisco jose de goya y lucientesgeorges joseph christian simenonpressure-feed lubricating systemcombined transport bill of lading
...View all with 29 letters...
Phrases (14)
reduced instruction set computingglutamic oxalacetic transaminaseuniversal gravitational constantaugust friedrich leopold weismanncalymmatobacterium granulomatiscomplex instruction set computingnontricyclic antidepressant drugsisters of st. michael the archangel1st viscount montgomery of alameinxinjiang uighur autonomous region
...View all with 30 letters...
Phrases (21)
great smoky mountains national parkbureau of intelligence and researchmarie louise elisabeth vigee-lebrundigital communications technologyguiseppe fortunino francesco verdisidonie-gabrielle claudine colettepalestine liberation organizationpalestinian popular struggle frontelectromotive drug administrationislamic great eastern raiders-front
...View all with 31 letters...
Phrases (17)
people against gangsterism and drugsweakly interacting massive particlesergei aleksandrovich koussevitzkystraight-line method of depreciationrevolutionary justice organizationcount nikolaus ludwig von zinzendorfnonsteroidal anti-inflammatory drugisidore auguste marie francois comteedmond louis antoine huot de goncourtlymphocytic choriomeningitis virus
...View all with 32 letters...
Phrases (15)
linear-quadratic-gaussian controllermusical instrument digital interfacecongress of industrial organizationsmusculus abductor digiti minimi manusmusculus abductor digiti minimi pedisorganization of the oppressed on earthprivilege against self incriminationright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometer
...View all with 33 letters...
Phrases (15)
federal national mortgage associationcosmic microwave background radiationinterstitial cell-stimulating hormonefriedrich august kekule von stradonitzeuropean law enforcement organisationvena centralis glandulae suprarenalisfunctional magnetic resonance imagingdryopithecus rudapithecus hungaricusclostridium perfringens epsilon toxinfour-stroke internal-combustion engine
...View all with 34 letters...
Phrases (8)
canadian security intelligence servicenational socialist german workers' partyimmigration and naturalization serviceanti-imperialist international brigadeballistic missile defense organizationsubacute sclerosing leukoencephalitisfraxinus pennsylvanica subintegerrimasecurity intelligence review committeePhrases (8)
jakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtnational geospatial-intelligence agencycriminal intelligence services of canadanatural language processing applicationtiberius claudius drusus nero germanicusunited states government printing office