Words Containing: MIA
(In Exact Order)
There are 588 words,
186 phrases and
1 abbr with
MIA in.
Best Scoring Words With: MIA
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| zamias | 6 | 17 | nounn | |||||
noun • any of various cycads of the genus Zamia; among the smallest and most verdant cycads | ||||||||
| umiaqs | 6 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| toxemia | 7 | 16 | nounn | |||||
noun • an abnormal condition of pregnancy characterized by hypertension and edema and protein in the urine • blood poisoning caused by bacterial toxic substances in the blood | ||||||||
| umiaq | 5 | 16 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| zamia | 5 | 16 | nounn | |||||
noun • any of various cycads of the genus Zamia; among the smallest and most verdant cycads | ||||||||
| umiacks | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| oomiack | 7 | 15 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| bohemia | 7 | 14 | nounn | |||||
noun • a group of artists and writers with real or pretended artistic or intellectual aspirations and usually an unconventional life style • a historical area and former kingdom in the Czech Republic | ||||||||
| amiably | 7 | 14 | adverb, adjectiveadv, adj | |||||
adverb • in an affable manner | ||||||||
| pyemias | 7 | 14 | nounn | |||||
noun • septicemia caused by pus-forming bacteria being released from an abscess | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (80)
bohemianleukemiajeremiahacademiaacidemiaischemiabahamiansemiaridbinomialnehemiahsapremiaadynamiaurinemiaarythmiajeremiadmiaowingendemialmonomialbulimiasanaemiasazotemiaoomiacksanoxemiagremialsparosmiacopremiamiasmatatoxemiasmiaulingproemialtoxaemiabohemiasamiantusastigmialeucemia
...View all with 8 letters...
Words (88)
leukaemiamacadamiahyperemiatrinomialhypoxemiatularemiadysthymiaketonemiaunamiablebohemiansmonomialsjeremiadsacademiasmiasmaticarythmiasencomiasthyphemiastoxaemiassicklemiaadynamiasprosimianazotemiassapraemiapeperomiaanoxemiasacidemiasischaemiaastigmiasparosmiascopremiasurinemiasbinomialsischemiashemialgiasemiangle
...View all with 9 letters...
Phrases (4)
bog kalmiaamia calvalake urmiagenus amiaWords (81)
arrhythmiasepticemiasemiannualnosocomialhemianopiaamiabilitypolynomialbacteremiaophthalmiahemiacetalencomiastshemialgiassemianglesprostomialhypoxemiasmacadamiasbinomiallytrinomialshyperemiassicklemiastularemiasischaemiasantinomiandysthymiasketonemiaserythremialeukaemiasprosimianssapraemiasamiantusespeperomiasantianemiaazotaemiasperidesmiaxerostomia
...View all with 10 letters...
Phrases (5)
samian waregenus samiamiami beachgenus zamiagenus nomiaWords (70)
hypothermiamesopotamiahypokalemiasemiaquaticthalassemiasepticaemiadysrhythmiaamiablenessencomiasticophthalmiasperistomialantinomianssemiariditysepticemiasbohemianismbacteremiasarrhythmiasamianthusesmiasmicallyprothalamiamultinomialazoospermiahemiacetalsepithalamiaerythremiaspolynomialscyclothymiaerythraemiabacteriemialeucodermiatrinomiallyacetonemiashypothymiastularaemiasdysthymiacs
...View all with 11 letters...
Phrases (7)
wormian bonezamia pumilagenus tamiasgenus anemiagenus kalmiazamia familygenus anomiaWords (52)
hyperthermiahyperkalemiahypoglycemiahyponatremiahypocalcemiasemiannuallysemiarborealamiabilitieshypokalemiasgalactosemiapolycythemiathalassemiasthalassaemiacyclothymiassemiabstractmultinomialshypothermiashyperlipemiadysrhythmiasbohemianismsnormothermiaazoospermiasschizothymiatrinomialismvindemiatingpachydermiasquadrinomialhyperthymiaserythraemiasleucodermiashypovolaemianeonomianismautotoxemiasoligospermiahemianopsias
...View all with 12 letters...
Phrases (7)
genus artemiamacadamia nutmiao languagesamia cynthiagenus adlumiagenus nanomiasamia walkeriWords (47)
semiautomatichypercalcemiapolycythemiashypocalcemiassemiariditieshyperlipemiasthalassaemiasgalactosemiashyperuricemiaantinomianismhyperthermiasnormothermiasxerophthalmiahypoglycemiashyperglycemiaamiablenesseshippopotamianlagerstroemiacyclothymiacshyponatraemiaexophthalmiaspanophthalmiahypernatremiaenterotoxemiaunamiablenessoligospermiaspolynomialismtrinomialismsanalbuminemiahyperlipaemiaquadrinomialsschizothymiashypocalcaemiahypoglycaemiapolycythaemia
...View all with 13 letters...
Phrases (12)
permian periodmeibomian cystcooley's anemiaisthmian gamesartemia salinagenus pongamiakamia languagemacadamia treeacute leukemiabladder ketmia
...View all with 13 letters...
Words (26)
semiautomaticssemiautonomousantinomianismshypercalcemiashyperlipidemiahypomagnesemiaxerophthalmiashyperuricemiashyperglycemiassemi-automatizexanthochromiasgalactosaemiasenantiodromiashyponatraemiashemoglobinemiapanophthalmiashypoglycaemiasleucocythaemiapolynomialismshyperglycaemiahypernatraemiaunamiabilitiesoligocythaemiahypercalcaemiapolycythaemiassemi-automatisePhrases (19)
tamias striatusaplastic anemiacooley's anaemiagenus peperomiagenus amianthumgenus bartramiabook of jeremiahfanconi's anemiagenus acrocomiabook of nehemiah
...View all with 14 letters...
Words (30)
schistosomiasisankylostomiasesschistosomiasesancylostomiasesankylostomiasisancylostomiasistrypanosomiasishyperlipidemiassemiabstractiontrypanosomiaseshypomagnesemiastachyarrhythmiaencomiasticallyoligocythaemiashaemoglobinemiahemiascomycetesspirochaetaemiahypomagnesaemiahypoproteinemiaafibrinogenemiaunamiablenessessemi-abstractionhyperglycaemiashyperlipoidemiaedriophthalmianleucocythaemiashypercalcaemiashyperlipidaemiahypernatraemiascholesterolemiaPhrases (18)
family lamiaceaebohemian waxwingchronic leukemiafanconi's anaemiamonic polynomialacromial processbinomial theoremgenus hippodamiaaplastic anaemiagenus macrozamia
...View all with 15 letters...
Words (5)
methemoglobinemiashyperbilirubinemiahypercholesteremiaagammaglobulinemiamacroglobulinemiasPhrases (17)
macrozamia communiskalmia angustifoliahyperchromic anemiamonocytic leukaemiatoxemia of pregnancymyelocytic leukemiacrescent-cell anemiametaplastic anaemiamacrozamia spiralispterocnemia pennata
...View all with 18 letters...
Words (4)
hypercholesterolemiaabetalipoproteinemiasemiautobiographicalhyperlipoproteinemiaPhrases (17)
class hemiascomycetesmediterranean anaemiamacadamia tetraphyllaophthalmia neonatorumiron deficiency anemiamegaloblastic anaemiasemiautomatic firearmsiderochrestic anemiamonoblastic leukaemiaacute myeloid leukemia
...View all with 20 letters...
Phrases (1)
ambrogio damiano achille rattiPhrases (1)
familial hypercholesterolemiaPhrases (1)
hyperbilirubinemia of the newbornPhrases (1)
marcus aurelius valerius maximianusPhrases (1)
harakat al-jihad al-islami al-filastini
