Words Containing: M,I,N,C,Y
(In Any Order)
There are 1,215 words,
1,723 phrases and
0 abbr's with
M,I,N,C,Y in.
Best Scoring Words With: M,I,N,C,Y
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| enzymic | 7 | 23 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| chimney | 7 | 17 | nounn | |||||
noun • a vertical flue that provides a path through which smoke from a fire is carried away through the wall or roof of a building • a glass flue surrounding the wick of an oil lamp | ||||||||
| dynamic | 7 | 15 | adjectiveadj | |||||
adjective • characterized by action or forcefulness or force of personality • of or relating to dynamics • (used of verbs (e.g. `to run') and participial adjectives (e.g. `running' in `running water')) expressing action rather than a state of being noun • an efficient incentive | ||||||||
| cymling | 7 | 15 | nounn | |||||
noun • squash plant having flattened round fruit with a scalloped edge; usually greenish white | ||||||||
| animacy | 7 | 14 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| cymlins | 7 | 14 | ||||||
Valid word for Scrabble US
| ||||||||
| criminy | 7 | 14 | ||||||
interjection • A minced oath that expresses surprise or impatience. | ||||||||
| cymlin | 6 | 13 | nounn | |||||
Valid word for Scrabble US
| ||||||||
| mincy | 5 | 12 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (1)
mincyWords (83)
communitymachinerymockinglyembryonicsymphonicgymnasticmilitancycomplyingmendacityimpotencyhypomanicenzymaticacronymicimmanencymendicitymisogynicgynoeciumimpudencygynaeciummanicallyneomycinscinnamonycalminglymonotypicchymosinschammyingmetonymiczymogeniccyanamidssyndromicrifamycinantonymickanamycinimminencydynamical
...View all with 9 letters...
Phrases (5)
by machinemint candymason citymichel neycommon ivyWords (116)
gymnasticspyromaniaccriminallymaniacallyconformitycharminglymenacinglypatronymicmalignancysanctimonyincumbencyaureomycineffeminacycraniotomychiromancybiodynamicmiscellanyvancomycininclemencymendicancymonohydricmicrifyingkanamycinshypermanicimportancyoxymoronicmycotoxinsactomyosinmonocyclicbecominglydynamisticcompanyingisoenzymictympaniticungimmicky
...View all with 10 letters...
Phrases (7)
mt. mckinleyoil companyglycine maxchinese yammorgan citypanama citymickey finnWords (151)
masculinityaerodynamiccriminologycriminalitycommonalitylaminectomymonozygoticdynamicallymythomaniachemodynamicmoronicallymedicinallynumericallycraniometryscreaminglymetonymicalcomminatoryecumenicitysyncretismsamphictyonyenzymicallycoembodyingcoemployingcoenzymaticmyasthenicscommunalitymythicizingdeterminacysynonymicalconfirmedlypyromaniacsincommoditychimneylikehyoscyaminehypnopompic
...View all with 11 letters...
Phrases (17)
laying claimlamp chimneycome in handycity managerfire companyfilm companyochna familyx-ray machinecynthia mothmexican onyx
...View all with 11 letters...
Words (195)
accompanyingmunicipalityeconomicallyromanticallynymphomaniacaerodynamicsmechanicallyanatomicallymisogynisticmonosyllabiccompanionwaycompellinglymagneticallyincomparablystreptomycinphysiognomicceremoniallyphotodynamichydrodynamicmeniscectomyperionychiumincompetencycontemptiblyecumenicallyharmonicallyincompletelyerythromycinmotorcyclingunmercifullyimpermanencyunbecominglyconfirmatorymendaciouslymunificentlysyndactylism
...View all with 12 letters...
Phrases (31)
islamic unityship's companytympanic veinichneumon flytype specimennancy mitfordsamia cynthiacombat injuryatomic energymercy killing
...View all with 12 letters...
Words (188)
complimentarymagnificentlyunsympatheticmystificationincompetentlyceremoniouslythermodynamicunimpeachablyhydrodynamicsindeterminacyendolymphaticcinematicallytonsillectomynonconformityunsymmetricalcommunicatoryenigmaticallyrecriminatorymonotonicallyenzymaticallygymnasticallycomplaininglyactinomycosesmicroanalysesimpecuniositymicroanalysisimpecuniouslymicroanalystsunmaliciouslyautonomicallycompendiouslynincompooperydysmenorrheicaerodynamicalegomaniacally
...View all with 13 letters...
Phrases (55)
direct antonymmount mckinleycooley's anemiascoring systemmexican hyssopmeibomian cystlivery companyzygomatic bonepoison mercurychimney corner
...View all with 13 letters...
Words (141)
cinematographythermodynamicsdiscriminatorychemosynthesispsychodynamicsastronomicallyappendicectomyhydropneumaticchemosyntheticnymphomaniacalcontumaciouslycyanocobalaminthymectomizingcomprehensiblycytotaxonomiesmonolithicallyhypermasculinerambunctiouslycompensabilitymonomaniacallymachineabilitymetaphysicianssystematicnessmisclassifyingimmunogenicitynonsymmetricalmetronomicallyelectrodynamichumanisticallyincommodiouslyhydrodynamicalcopolymerizingantidromicallymultifrequencyencyclopedisms
...View all with 14 letters...
Phrases (97)
trionyx muticuscooley's anaemiasymphonic musicmoral certaintyemily dickinsongenus nymphicusdynamic balancedynamic speakerbinary compoundmilitary action
...View all with 14 letters...
Words (135)
incompatibilityaerodynamicallycardiopulmonarycompassionatelyuncomplimentarycommunicabilitygastronomicallygynandromorphicunceremoniouslycomprehensivelysymmetricalnessaccommodatinglyunsymmetricallycontemptibilitysanctimoniouslycentrosymmetricsemidocumentarycommiseratinglycontemplativelydemystificationcomplementaritymicroanalyticalhydromechanicalmerchantabilitycyanocobalaminecyanocobalaminsincomparabilitypsychometriciancompositionallyhyperexcitementancylostomiasesancylostomiasiscyclohexylamineuncomplaininglysemicylindrical
...View all with 15 letters...
Phrases (114)
dialysis machinefamily lemnaceaejohn quincy adamsgenus bombycillahyoscyamus nigerstonecrop familypipeline companyrhythmic patterncantering rhythmafrican mahogany
...View all with 15 letters...
Words (70)
indiscriminatelyincomprehensiblyuncompromisinglycircumstantiallymonosyllabicallythrombocytopeniadiscriminatorilyparamagneticallycommensurabilitynoncompetitivelycommonsensicallymonochromaticitythrombocytopenicmonopolisticallymonosynapticallymonotheisticallycriminologicallycyanocobalaminescyclohexylaminesimmunochemicallyoxyphencycliminelymphangiectasialymphangiectasispharmacodynamicsonomatopoeicallyimmunoreactivitysyncategorematicphonogrammicallysemitransparencyundiplomaticallymechanochemistryactinomycetaceaemegalomaniacallyhelminthostachysalphanumerically
...View all with 16 letters...
Phrases (145)
hypodermic needletympanic membranefamily cyprinidaechemical analysisamerican sycamorecommercial agencyofficial immunitymechanical systemfamily punicaceaeanti-masonic party
...View all with 16 letters...
Words (39)
thermodynamicallyincommunicabilitysocioeconomicallymultidisciplinarymonochromaticallythrombocytopeniasmonosyllabicitiesferrimagneticallymorphogeneticallyencephalomyelitismicropaleontologylymphangiographicmacroevolutionarycytotaxonomicallyimmunogeneticallyonomatopoeticallynephelometricallysamoyedic-speakingglycosaminoglycantrigonometricallyaerothermodynamicunsympatheticallycomprehensibilitycopolymerizationsmicrodensitometryincompressibilityphotomechanicallymicroevolutionaryanticlimacticallydeterministicallyuncomprehendinglypsychodynamicallysymmetricalnesseschymotrypsinogensnondiscriminatory
...View all with 17 letters...
Phrases (187)
mary leontyne pricebalaena mysticetusczech monetary unitproteolytic enzymelycopodium alpinumhypoglycemic agentcuban monetary unitlycopus americanussubphylum craniataprimary censorship
...View all with 17 letters...
Words (16)
multifunctionalitynoncomprehensivelyhypophysectomizingcylindrical-stemmedimmunocytochemicalmagnetostrictivelyphenomenologicallyglycosaminoglycansaerothermodynamicsincommensurabilitymicrocrystallinitysedimentologicallysemiconservativelyindiscriminatinglydiethylcarbamazinesomnambulisticallyPhrases (162)
bombycilla cedrorunlachrymal secretioncolumbia universityread-only memory chipmetric capacity unitfulminate of mercurygenus chamaecytisusfamily loranthaceaefulminating mercuryfamily magnoliaceae
...View all with 18 letters...
Words (18)
cinematographicallyimmunocytochemistrymagnetohydrodynamicpharmacodynamicallyphenomenalisticallyphenylthiocarbamidemercury-contaminatedelectromagneticallyelectromechanicallyinterferometricallyimpressionisticallyanthropomorphicallyincomprehensibilitymicroelectronicallyencephalomyelitidesdihydrostreptomycindiethylcarbamazineshypoadrenocorticismPhrases (179)
family cynoglossidaephytolacca americanagenus symphoricarposnancy freeman mitfordathyrium pycnocarponchinese monetary unitdasypus novemcinctussymphytum officinalefamily zingiberaceaemexican monetary unit
...View all with 19 letters...
Words (11)
hyperadrenocorticismimmunocytochemicallymagnetofluiddynamicsphenylthiocarbamidesoophorosalpingectomymagnetohydrodynamicshistoincompatibilitymicrocrystallinitiesimmunohistochemistryencephalomyocarditissyncategorematicallyPhrases (141)
marchantia polymorphamechanically skillfulmagnetic bubble memoryclassification systemsouth american countryorder actinomycetalesluscinia megarhynchosmilitary intelligencenymphicus hollandicusfamily gleicheniaceae
...View all with 20 letters...
Words (2)
immunocytochemistriesantiferromagneticallyPhrases (100)
icelandic monetary unitcynoglossum officinaleginglymostoma cirratumcambodian monetary unitcolombian monetary unitcongenital abnormalitycape verde monetary unitprosopium cylindraceumacanthocybium solandrivladimir ilyich ulyanov
...View all with 21 letters...
Words (2)
intercomprehensibilityencephalomyocarditisesPhrases (105)
lycopersicon esculentumfamily dendrocolaptidaerhythm and blues musiciannicaraguan monetary unitfamily branchiostomidaecombined dna index systemedna saint vincent millayamygdalus communis amaraparliamentary proceduredisplaying incompetence
...View all with 22 letters...
Words (1)
immunoelectrophoreticallyPhrases (43)
michelson-morley experimentlepidocybium flavobrunneumreticular activating systemtympanuchus pallidicinctusembryonic stem-cell researchreticuloendothelial systemcygnus columbianus bewickiinational academy of sciencessystematic desensitisationsystematic desensitization
...View all with 25 letters...
Phrases (39)
dorothy mary crowfoot hodgkinhuman immunodeficiency virusemployee stock ownership planassyrian neo-aramaic languagecharles maurice de talleyrandrevolutionary calendar monthsubdivision basidiomycotinasubdivision deuteromycotinasubdivision mastigomycotinaentandrophragma cylindricum
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (24)
american revolutionary leaderholy roman emperor frederick iicommissioned military officernuclear regulatory commissionjames augustine aloysius joyceinformation processing systematrioventricular nodal rhythmsystema nervosum periphericumhydraulic transmission systemhypothalamic releasing factor
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (31)
marcus junius brutus the youngercardiopulmonary resuscitationmicrosoft disk operating systemdepartment of homeland securitymaster of arts in library sciencedissident irish republican armyrevolutionary communist leagueface-amount certificate companysmall computer system interfacecygnus columbianus columbianus
...View all with 28 letters...
Phrases (15)
automatic data processing systemsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeehydrangea macrophylla hortensisnational intelligence communitytheory of punctuated equilibriumanonymous file transfer protocolpressure-feed lubricating systemcypripedium calceolus pubescens
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (12)
obsessive-compulsive personalitydepartment of energy intelligenceethylenediaminetetraacetic acidbalance of international paymentswaterhouse-friderichsen syndromesevere acute respiratory syndromesevere combined immunodeficiencypolymonium caeruleum van-bruntiaecalymmatobacterium granulomatis1st viscount montgomery of alamein
...View all with 30 letters...
Phrases (9)
digital communications technologytupac amaru revolutionary movementrecombinant deoxyribonucleic acidrichard august carl emil erlenmeyerinternational atomic energy agencymarie anne charlotte corday d'armontmarine corps intelligence activitydefense information systems agencymary godwin wollstonecraft shelleyPhrases (10)
nikolai andreyevich rimski-korsakovhierarchical classification systemweakly interacting massive particlenikolai andreyevich rimsky-korsakovlymphocytic choriomeningitis virustyrannus domenicensis domenicensisprogressive emphysematous necrosischrysanthemum coronarium spatiosumamaranthus hybridus erythrostachysacquired immune deficiency syndromePhrases (10)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavamercury-in-glass clinical thermometersecretary of health and human servicesinternational law enforcement agencycapital: critique of political economypositron emission tomography scanneridiopathic thrombocytopenic purpuraamaranthus hybridus hypochondriacusunited states intelligence communityPhrases (8)
severe combined immunodeficiency diseasetrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and scienceskarl friedrich hieronymus von munchhausenus army criminal investigation laboratoryunited states national library of medicinePhrases (1)
enzyme-linked-immunosorbent serologic assay
