Words Containing: L,Y,P,R
(In Any Order)
There are 3,548 words,
2,407 phrases and
0 abbr's with
L,Y,P,R in.
Best Scoring Words With: L,Y,P,R
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
prickly | 7 | 18 | adjectiveadj | |||||
adjective satellite • very irritable • having or covered with protective barbs or quills or spines or thorns or setae etc. | ||||||||
sparkly | 7 | 16 | adjectiveadj | |||||
adjective satellite • marked by high spirits or excitement • having brief brilliant points or flashes of light | ||||||||
perkily | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a perky manner | ||||||||
crumply | 7 | 16 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
sharply | 7 | 15 | adverbadv | |||||
adverb • in an aggressive manner • in a well delineated manner • changing suddenly in direction and degree • very suddenly and to a great degree | ||||||||
privily | 7 | 15 | adverbadv | |||||
adverb • confidentially or in secret | ||||||||
flytrap | 7 | 15 | nounn | |||||
noun • a trap for catching flies | ||||||||
palfrey | 7 | 15 | nounn | |||||
noun • especially a light saddle horse for a woman | ||||||||
replevy | 7 | 15 | verbv | |||||
noun • Replevin verb • To return goods to their rightful owner by replevin; to recover goods. • To bail. | ||||||||
sprawly | 7 | 15 | adjectiveadj | |||||
adjective satellite • extended out irregularly | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (76)
rapidlypayrollproudlysharplypresleypoultrypricklyleprosyparsleysparklypolymerpyloricpilloryreapplyairplaypalmyraplenarylampreyprivilyflytrapsplurgycrisplypalfreypyralidreplevyparleyspalmarypriorlypricilyyelperspedlarypropylssparelyperkilysprawly
...View all with 7 letters...
Phrases (1)
h. pyloriWords (153)
probablyproperlyslipperyemployerforeplayabruptlypromptlyrohypnolpriestlyparalyzepolarityresupplyplayroomsuperblywordplayprincelyplaygirlexpertlyparalysepleurisyflypaperprettilysparselyoverplayparleyedsportilyupwardlyredeployroleplayprovablydrippilytorpidlyfrumpilychirpilygrumpily
...View all with 8 letters...
Phrases (11)
cd playerglory peadry platepep rallyword playdraw playtrap playrely uponfly pressleap year
...View all with 8 letters...
Words (266)
perfectlypreciselyparalyzedprivatelyprimarilypresentlypartiallyparalysispurposelyexemplaryplanetaryparalysedpolygraphpulmonaryexpresslyportrayalpolyesterswordplayprofuselyparalyticsupremelyhorseplaypyramidalhyperbolesprightlycapillarysparinglyplaymakerreputedlyinterplaypopularlyplayactorparleyingpermalloypapillary
...View all with 9 letters...
Phrases (25)
keep relaygrass polyivory palmparty girldirty poolparty lineparty wallforce playpower playorly group
...View all with 9 letters...
Words (411)
apparentlypersonallypreviouslyscreenplayplaygroundrepeatedlyseparatelypreferablypopularitypresumablyprofoundlycompulsoryreportedlyplaywrightupholsterypowerfullyballplayernarcolepsyimproperlyphrenologyarchetypalproximallyprofitablynephrologymorphologyphylloxeraprofligacyparalysingperilouslyhieroglyphapocryphalproclivitypeculiarlyperverselyproslavery
...View all with 10 letters...
Phrases (48)
golf playerrole playeralkyl groupst. polycarpglyptic artmaple syrupgrape jellyhoward pyletwyla tharpplay tricks
...View all with 10 letters...
Words (490)
personalitypracticallyimportantlydesperatelytemporarilypreliminarypermanentlyprobabilitycalligraphyspirituallyprematurelychlorophyllpterodactylresponsiblyperpetuallyexplanatorypyroclasticprincipallylaparoscopyhorseplayerexploratorypolystyrenepredictablyplaywritingpolymorphicsphericallypleasurablypeculiarityphraseologyirreparablythermopylaerhinoplastyprominentlygraphicallyopportunely
...View all with 11 letters...
Phrases (83)
playing areaspecial juryrunning playbald cypresspiano playerpolicy makerbenzyl grouplap of luxuryflute playerchess player
...View all with 11 letters...
Words (506)
particularlysurprisinglydisciplinaryrespectfullyhypocriticalspiritualityanthropologyparamilitaryperiodicallyrespectivelyperipherallyhieroglyphicpersistentlytriumphantlypurposefullyhypochloritephilanthropypharmacologyprecariouslyimpartialityprophylacticproficientlypolicyholderpejorativelypracticalityimpressivelypolyurethaneprincipalitybibliographyparalyzationhyperkalemiaproverbiallysporadicallydepressinglydespairingly
...View all with 12 letters...
Phrases (118)
chlorophyll amolly pitcherhorn of plentyacrylic paintpoverty leveldramatic playreal propertytennis playerpetit larcenyperiod of play
...View all with 12 letters...
Words (478)
approximatelyappropriatelycomplimentaryparliamentaryprogressivelyhieroglyphicspredominantlyimprobabilityspectacularlyparadoxicallycomparativelycomplementarysupplementarystereotypicalirresponsiblysuperficiallyimperceptiblypreliminarilyneurosyphilisparticularityprofitabilityprovisionallyprovocativelypredominatelyhydrocephalushypercalcemiaparabolicallydisparaginglypatrioticallypicturesquelyhyperglycemicpolycarbonatetransparentlytypographicalsuperlatively
...View all with 13 letters...
Phrases (133)
myrobalan plumholy sepulcherholy sepulchrebattle of ypresheavy particledna polymerasecocktail partycyperus longusmonopoly boardgenus pyrrhula
...View all with 13 letters...
Words (406)
responsibilityprofessionallymetaphoricallyrespectabilitygeographicallyinterplanetaryelectrotherapyhyperventilateproportionallyparapsychologypredictabilitysupernaturallyexperimentallyreproductivelyappreciativelysuperficialitychlorophyllousphosphorylatedpolymerizationpyelonephritisprovidentiallyorthopedicallyplethysmographimpracticalitydepartmentallyarchetypicallybiographicallyneuropathologypreferentiallydisapprovinglypreposterouslypraiseworthilyoverpoweringlyimpermeabilityhyperbolically
...View all with 14 letters...
Phrases (151)
pearl mae baileytubal pregnancypituitary glandvisual propertypolymeric amidelacrosse playerchinese parsleyprogram librarykyrgyz republicrudyard kipling
...View all with 14 letters...
Words (302)
inappropriatelydisrespectfullyoversimplifyingsurreptitiouslyparentheticallyplenipotentiarymicroscopicallyproportionatelycardiopulmonarytherapeuticallyneurophysiologyuncomplimentaryencephalographypostoperativelyintrospectivelyunparliamentaryproportionalityuninterruptedlypolyunsaturatedinspirationallycrystallographyhypochondriacalcorrespondinglyretrospectivelydemographicallyunprecedentedlypsychiatricallycomprehensivelytemperamentallyperpendicularlyultrasonographyimperishabilityapproachabilityreproducibilityteletypewriters
...View all with 15 letters...
Phrases (180)
alimentary pasteebony spleenwortfamily leporidaestonecrop familyscholarly persongempylus serpensbroomrape familycomplex body partcapital of norwayinsurance policy
...View all with 15 letters...
Words (162)
irresponsibilityincomprehensiblycatastrophicallytriphenylmethanehyperintelligentunpredictabilityhyperventilationimperceptibilityuncompromisinglyelectromyographypharmaceuticallyextemporaneouslyphotographicallyunprofessionallyparapsychologistincorruptibilitypolydispersitieshypersalivationsparadigmaticallypolyelectrolytespornographicallyparaformaldehydeantistrophicallyspondylarthritisextracorporeallyparamagneticallyradiographicallyhypersexualitieshypersomnolencespolyrhythmicallythermoplasticityhyperstimulatingparaphrasticallyhyperstimulationimperfectibility
...View all with 16 letters...
Phrases (197)
hypodermic needlestrictly speakingfamily cyperaceaefamily cyprinidaecapital of hungaryin all probabilitypodocarpus familyvolleyball playerexemplary damagesprotoctist family
...View all with 16 letters...
Words (106)
anthropologicallyperchloroethyleneneurophysiologistcontemporaneouslyphilanthropicallymultidisciplinaryprobabilisticallyinterdisciplinarycercidiphyllaceaepolymorphonuclearparaformaldehydesradioisotopicallyhyperstimulationsparapsychologistsparasitologicallyspectroscopicallyhyperventilationsnonprofessionallyhypochondriacallypaternalisticallymorphogeneticallylexicographicallycryptocrystallinelaryngopharyngealcrystallographerspentylenetetrazolcrystallographiespostrevolutionarymicropaleontologydisrespectabilitytranscriptionallyhyperalimentationlymphangiographictransdisciplinarylymphogranulomata
...View all with 17 letters...
Phrases (225)
gopherus polypemusmary leontyne priceproteolytic enzymepearly everlastingclass rhodophyceaelycopus americanussubphylum craniatacylinder separatorrepublic of hungarycapital of maryland
...View all with 17 letters...
Words (56)
disproportionatelyhypercoagulabilitypsychopharmacologyhyperaldosteronismneuropsychologicalpolyesterificationspectrofluorometrypolymorphonuclearsspectroheliographypolyribonucleotidenoncomprehensivelypentylenetetrazolslaryngopharyngitisperchloroethyleneslipopolysaccharidelymphangiographieshyperbilirubinemiastereospecificallyautobiographicallymucopolysaccharidehypercholesteremiamyeloproliferativesubmicroscopicallyoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesispolypropenonitrileneurophysiologistsrepresentationallyelectromyographiesneuropsychologistsmetallographicallyelectrooculographyelectrophotography
...View all with 18 letters...
Phrases (226)
worldly possessionsrevolutionary groupfamily physeteridaefreudian psychologyperomyscus leucopusread-only memory chipkilocycle per secondsuperiority complexfamily asparagaceaemegacycle per second
...View all with 18 letters...
Words (40)
cinematographicallypolyesterificationspolyribonucleotideshypersusceptibilityhypolipoproteinemiaparthenogeneticallymucopolysaccharideslipopolysaccharidesbacteriochlorophyllpharmacodynamicallyphenylthiocarbamidechromatographicallyechoencephalographyphosphoenolpyruvateinterdepartmentallyhysterosalpingogramimpressionisticallyelectrophoreticallymethylprednisoloneselectrophysiologieselectrophysiologistanthropocentricallyanthropomorphicallyelectroretinographyincomprehensibilitycortico-hypothalamicphenylpropanolaminehistoriographicallyoverproportionatelypsychopharmacologicphytogeographicallyhyperemotionalitiesdimethyltryptamineshyperexcitabilitiescytophotometrically
...View all with 19 letters...
Phrases (196)
water-plantain familyfamily cyclopteridaeclass polyplacophoraalpine type of glacierphytolacca americanafamily dasyproctidaecapital of kyrgyzstanfamily tropaeolaceaehydrobates pelagicussubfamily perdicidae
...View all with 19 letters...
Words (29)
hypercholesterolemiapolyphiloprogenitivelipochondrodystrophycrystallographicallylymphogranulomatoseslymphogranulomatosisbacteriochlorophyllsphenylpropanolaminesphenylthiocarbamidesoophorosalpingectomyphosphoenolpyruvatesneurophysiologicallyneuropsychiatricallyhyperlipoproteinemiaphotoautotrophicallyultramicroscopicallyelectrophysiologicalelectrophysiologistsroentgenographicallyencephalomyocarditischemotherapeuticallyphotophosphorylationpsychopharmacologiesmicrophotometricallypsychopharmacologisthypercholesterolemichypercoagulabilitiespalatopharyngoplastyplethysmographicallyPhrases (175)
balaenoptera physalusfamily trachipteridaemarchantia polymorphadianthus caryophyllusfriendly relationshipclosure by compartmenta-scan ultrasonographyamyloid protein plaquepolitically incorrectglycerol tripalmitate
...View all with 20 letters...
Words (12)
psychopharmacologicalhypersusceptibilitiesstereomicroscopicallymucopolysaccharidosisphosphoglyceraldehydeelectromyographicallyphotolithographicallypolyvinyl-formaldehydephotophosphorylationshypercholesterolemiaspsychopharmacologistspsychotherapeuticallyPhrases (149)
eucalyptus fraxinoidesisle royal national parkarctostaphylos uva-ursispectroscopic analysisprocaine hydrochloridefamily myrmecophagidaeprosopium cylindraceumpercy aldridge graingersuperfamily tyrannidaesense of responsibility
...View all with 21 letters...
Words (8)
pentamethylenetetrazolspectrophotometricallyintercomprehensibilityelectroencephalographyphosphoglyceraldehydeselectrophysiologicallyencephalomyocarditisesdihydroxyphenylalaninePhrases (121)
lycopersicon esculentumhaliaeetus leucorhyphusredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathysodium tripolyphosphatehigh-density lipoproteinathyrium thelypteroidesmale reproductive systematmospheric electricity
...View all with 22 letters...
Words (2)
polytetrafluoroethylenehypobetalipoproteinemiaPhrases (101)
posterior pituitary glandmeperidine hydrochlorideyellowstone national parkcanyonlands national parkdorothy rothschild parkersciadopitys verticillatatricyclic antidepressanthydrophyllum virginianumeastern malayo-polynesiansir anthony philip hopkins
...View all with 23 letters...
Words (3)
hyperbetalipoproteinemiaelectrocardiographicallymicroelectrophoreticallyPhrases (57)
subphylum cephalochordataprivately held corporationapocynum androsaemifoliumfederal republic of germanychrysosplenium americanumanal retentive personalityoxidative phosphorylationelectroconvulsive therapypelecanus erythrorhynchossuperior cerebellar artery
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyuvulopalatopharyngoplastyPhrases (38)
myroxylon balsamum pereiraesymphoricarpos orbiculatuspropoxyphene hydrochloridepolystichum acrostichoidesmelanerpes erythrocephaluscaulophyllum thalictroidestrans-alaska pipeline systempyotr alexeyevich kropotkinmichelson-morley experimentconstant of proportionality
...View all with 25 letters...
Phrases (37)
employee stock ownership planbureau of diplomatic securityentandrophragma cylindricumbenign prostatic hyperplasiapalestine national authoritysystemic lupus erythematosusscardinius erythrophthalmussuperorder labyrinthodontianontricyclic antidepressantintermediate temporal artery
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (31)
holy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyanapull the wool over someone's eyestricyclic antidepressant drugthyrotropin-releasing hormonecryptobranchus alleganiensisprincipality of liechtenstein
...View all with 27 letters...
Phrases (20)
revolutionary people's struggleephippiorhynchus senegalensistriphosphopyridine nucleotidecardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armyrevolutionary proletarian armysmall computer system interfacesingle nucleotide polymorphismimperial japanese morning glory
...View all with 28 letters...
Phrases (15)
antisocial personality disorderinternational olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensispresident william henry harrisonultrasonic pulse velocity testertheory of punctuated equilibriumanonymous file transfer protocolpressure-feed lubricating systemcypripedium calceolus pubescens
...View all with 29 letters...
Phrases (18)
battle of spotsylvania court housebattle of spotsylvania courthouseobsessive-compulsive personalityself-report personality inventorydepartment of energy intelligencedepository financial institutionbalance of international paymentspolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalifornia personality inventory
...View all with 30 letters...
Phrases (8)
lycopersicon esculentum cerasiformepityrogramma calomelanos aureoflavanondepository financial institutionright to speedy and public trial by juryfloating-point representation systemhighly active antiretroviral therapycapital: critique of political economyphysiological jaundice of the newbornPhrases (1)
socialist people's libyan arab jamahiriya