Words Containing: L,Y,M,P
(In Any Order)
There are 1,798 words,
1,716 phrases and
0 abbr's with
L,Y,M,P in.
Best Scoring Words With: L,Y,M,P
| More words | ||||||||
|---|---|---|---|---|---|---|---|---|
| Expand? | Word | Save? | Length | Usage | Points | Type | ||
| jumpily | 7 | 21 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| jimply | 6 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
| phlegmy | 7 | 18 | adjectiveadj | |||||
adjective • characterized by phlegm | ||||||||
| amplify | 7 | 17 | verbv | |||||
verb • increase in size, volume or significance • to enlarge beyond bounds or the truth • exaggerate or make bigger • increase the volume of | ||||||||
| nymphal | 7 | 17 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| shlumpy | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
| phylum | 6 | 16 | nounn | |||||
noun • (linguistics) a large group of languages that are historically related • (biology) the major taxonomic group of animals and plants; contains classes | ||||||||
| plumply | 7 | 16 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| crumply | 7 | 16 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
| lymphs | 6 | 16 | nounn | |||||
noun • a thin coagulable fluid (similar to plasma but) containing white blood cells (lymphocytes) and chyle; is conveyed to the blood stream by lymphatic vessels | ||||||||
| or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | ||||||||
Words (84)
employeeolympicsemployedemployermultiplymonopolyimplyingplaytimepromptlysimplifyplymouthplaymatepolygamyolympiadplayroomlymphomapalimonyolympianpolymathimpishlypsalmodyfrumpilypolysemyskimpilymisapplygrumpilyempyreallimpidlyemployesmopishlyglumpilylymphoidptyalismreemployphyllome
...View all with 8 letters...
Phrases (7)
pay claimlumpy jawyam plantmay appleptolemy ilady palmdavy lampWords (149)
primarilyblasphemyexemplarydiplomacypulmonarysupremelypyramidalpygmalionlymphaticplaymakercomplyingpermalloypalmistrycytoplasmamblyopiacomplexlypompouslypolymorphexemplifyoptimallyampullarybumpkinlylimpidityphyllomesphyllomicplaymatesptyalismslimpinglyprimalityvampishlyemployeespolymericpermeablypolymyxinmicropyle
...View all with 9 letters...
Phrases (18)
lymph cellmatch playtype metalmt. olympusswamp lilylymph nodeemily postivory palmmedal playptolemy ii
...View all with 9 letters...
Words (205)
completelyunemployedemploymentpresumablysimplicitycompulsorycomplexitydeploymentcomplicitylymphocyteimproperlyimpossiblyimplicitlyimpeccablyproximallymorphologylycopodiumpolygamistamplifyingparoxysmalimpudentlypolygamouspolytheismmysophiliaphlebotomylymphedemaclypeiformmycoplasmaimplacablycompatiblypolynomiallaparotomyemployabletemporallylumpectomy
...View all with 10 letters...
Phrases (24)
palm familyoil companypink familymaple syrupolympic godsea lampreytype familypine familydumpy levellymph gland
...View all with 10 letters...
Words (245)
importantlytemporarilypreliminarypermanentlyprematurelymultiplyingimpatientlycomplacencyimpulsivelypolymorphicsimplifyingthermopylaecompetentlyprominentlyhypokalemiaprimitivelyhypokalemicempiricallyimperfectlyimpetuouslyhypovolemicimpermeablypromisinglyfilmographylymphocyticimpartiallyimprudentlysumptuouslyimplausiblysplenectomyamphibologypolemicallysympetaloussymptomlessimploringly
...View all with 11 letters...
Phrases (35)
playoff gamepolicy makerlamp chimneypoppy familypeace symbolmeryl streepalpha rhythmpearl hominyfilm companycrape myrtle
...View all with 11 letters...
Words (241)
unemploymentmunicipalitymetaphysicalparamilitaryhypothalamustriumphantlyemphaticallypharmacologyunemployablecompulsivelyphenomenallyimpartialitycompellinglyhypoglycemicimpressivelyposthumouslyhyperkalemiaepidemiologymultiplicityincomparablyredeploymenthypoglycemiaoversimplifycomplacentlyimpersonallyexemplifyinglymphomatoidcontemptiblypermeabilityhypocalcemiaperemptorilypolymorphoushypothalamicincompletelysuperhumanly
...View all with 12 letters...
Phrases (50)
molly pitcherdramatic playpapaya familymilitary postmesh topologypyriform lobeprotea familyclumsy personmethyl phenolvinyl polymer
...View all with 12 letters...
Words (263)
approximatelycomplimentaryimpossibilityparliamentarycompatibilitypredominantlyimprobabilitycomparativelycomplementarysupplementaryimperceptiblyhypoglycaemicpreliminarilycompetitivelypredominatelyhypercalcemiaincompetentlyhyperglycemicimpermissiblyimpertinentlyunimpeachablylymphoblasticpolydactylismsupernormallyendolymphaticspasmodicallyimplacabilitypolychromaticophthalmologylymphosarcomaamitriptylinepromiscuouslypragmaticallyimpassabilitypusillanimity
...View all with 13 letters...
Phrases (63)
myrobalan plumfamily picidaefamily poaceaeplum-yew familydna polymerasemonopoly boardamyloid plaquelivery companyorphans' asylumprinted symbol
...View all with 13 letters...
Words (183)
metaphoricallycontemptuouslyexperimentallymetaphysicallydiplomaticallyoptimisticallypolymerizationsimplisticallyplethysmographimpracticalitydepartmentallynymphomaniacalimpermeabilityempatheticallyimpregnabilitycomprehensiblydepolymerizingaminophyllineshypermasculinecompensabilityparametricallypresumptuouslysupereminentlysymptomatologyperformabilitydiphenylaminesplatyhelminthsplethysmogramspyrometallurgyparsimoniouslypermissibilitycopolymerizingmyrmecophilousnaphthylaminesamphiprostyles
...View all with 14 letters...
Phrases (102)
family apiaceaepearl mae baileypolymeric amidemost especiallyfamily vespidaeprogram librarypersonal memorypulmonary trunkphylum annelidaphylum chordata
...View all with 14 letters...
Words (147)
lymphadenopathyincompatibilitydevelopmentallyoversimplifyingmicroscopicallycardiopulmonarycompassionatelyuncomplimentarymethylphenidateunparliamentarysympatheticallydemographicallyeuphemisticallypessimisticallycomprehensivelytemperamentallyimperishabilitycontemptibilitycontemplativelyemployabilitiescomplementarityimponderabilitysymptomaticallypoliomyelitidesincomparabilityhypersomnolenceunemployabilityhyperstimulatedhyperstimulatescompositionallypolymerisationsuncomplaininglypolyacrylamideshyperinsulinismphotometrically
...View all with 15 letters...
Phrases (133)
alimentary pastefamily leporidaestonecrop familyfamily lophiidaepipeline companygempylus serpensbroomrape familycomplex body partlymphatic vesselassembly program
...View all with 15 letters...
Words (81)
incomprehensiblytriphenylmethaneimperceptibilityuncompromisinglyelectromyographypharmaceuticallyextemporaneouslyparadigmaticallyhymenophyllaceaeparaformaldehydeparamagneticallynoncompetitivelyhypersomnolencespolyrhythmicallythermoplasticityhyperstimulatinghyperstimulationimperfectibilityantiunemploymentmalayo-polynesianmonopolisticallymonosynapticallyhemoglobinopathymorphometricallyasymptomaticallycyclophosphamideoxyphencycliminelymphogranulomasimpermissibilitymultiplicativelyhypothalamicallyimperturbabilitylymphangiectasialymphangiectasislymphangiography
...View all with 16 letters...
Phrases (155)
hypodermic needlefamily cyperaceaefamily cyprinidaepodocarpus familyexemplary damagescalystegia sepiumprotoctist familyfamily punicaceaefamily pythonidaegrand mal epilepsy
...View all with 16 letters...
Words (55)
contemporaneouslymultidisciplinarypolymorphonuclearparaformaldehydeshyperstimulationsmorphogeneticallyencephalomyelitismicropaleontologylymphadenopathieshyperalimentationlymphangiographiccyclophosphamideslymphogranulomatapharmacologicallythiodiphenylamineonomatopoeticallyphenylethylaminesnephelometricallyimperialisticallytriphenylmethaneschromolithographyneuropharmacologyelectromyographicimpressionabilityunsympatheticallyimprovisationallymetapsychologicalultracontemporaryamphitheatricallymethylnaphthalenecomprehensibilitycopolymerizationsdepolymerizationsincompressibilityphotomechanically
...View all with 17 letters...
Phrases (174)
gopherus polypemusmary leontyne priceproteolytic enzymelycopodium alpinumhypoglycemic agentfamily dasypodidaelycopus americanussubphylum craniatagenus symphalangusfamily didelphidae
...View all with 17 letters...
Words (26)
psychopharmacologyhyperaldosteronismspectrofluorometrypolymorphonuclearsnoncomprehensivelylymphangiographieshyperbilirubinemiamucopolysaccharidehypercholesteremiamyeloproliferativephenomenologicallyophthalmologicallysubmicroscopicallyelectromyographiesmetallographicallyhistocompatibilitymethylnaphthalenesmethylprednisolonecounterdeploymentsoveroptimisticallyhyperalimentationssemiprofessionallyphytohemagglutinindimethyltryptaminepolychromatophiliapolychromatophilicPhrases (172)
family physeteridaeperomyscus leucopuspodilymbus podicepsread-only memory chipsuperiority complexfamily asparagaceaemegacycle per secondfamily polygalaceaearthur holly comptonpolish monetary unit
...View all with 18 letters...
Words (24)
cinematographicallyhypolipoproteinemiamucopolysaccharidespharmacodynamicallyphenomenalisticallyphenylthiocarbamidechromatographicallyinterdepartmentallyhysterosalpingogramimpressionisticallymethylprednisolonesanthropomorphicallyincomprehensibilitycortico-hypothalamicencephalomyelitidesphenylpropanolaminepsychopharmacologicsymptomatologicallyphytohemagglutininspsychotomimeticallyhyperemotionalitiesdimethyltryptaminescytophotometricallypolychromatophiliasPhrases (160)
water-plantain familyfamily cyclopteridaephytolacca americanafamily lepisosteidaefamily dasyproctidaefamily tropaeolaceaefamily polypodiaceaesymphytum officinalesubfamily mephitinaesubfamily perdicidae
...View all with 19 letters...
Words (16)
hypercholesterolemialymphogranulomatoseslymphogranulomatosisphenylpropanolaminesphenylthiocarbamidesoophorosalpingectomyhyperlipoproteinemiahistoincompatibilityultramicroscopicallyencephalomyocarditischemotherapeuticallypsychopharmacologiesmicrophotometricallypsychopharmacologisthypercholesterolemicplethysmographicallyPhrases (144)
wyethia amplexicaulisfamily phytolaccaceaefamily trachipteridaedevelopmental anatomymarchantia polymorphafamily pseudococcidaeclosure by compartmentamyloid protein plaqueglycerol tripalmitatesupplementary benefit
...View all with 20 letters...
Words (8)
psychopharmacologicalhypogammaglobulinemiastereomicroscopicallymucopolysaccharidosiselectromyographicallypolyvinyl-formaldehydehypercholesterolemiaspsychopharmacologistsPhrases (120)
ptolemy ii philadelphusfamily myrmecophagidaephylum platyhelminthesprosopium cylindraceumphysical impossibilitysuperfamily tyrannidaefamily peronosporaceaefamily phyllocladaceaeandromeda glaucophyllaleiophyllum buxifolium
...View all with 21 letters...
Words (4)
pentamethylenetetrazolspectrophotometricallyintercomprehensibilityencephalomyocarditisesPhrases (90)
lycopersicon esculentumredevelopment authorityfamily dendrocolaptidaemultiple mononeuropathysodium tripolyphosphateathyrium thelypteroidesmale reproductive systematmospheric electricityparliamentary proceduresamuel pierpoint langley
...View all with 22 letters...
Words (1)
hypobetalipoproteinemiaPhrases (74)
meperidine hydrochloridehydrophyllum virginianumeastern malayo-polynesianamerican federalist partywestern malayo-polynesiancamptosorus rhizophyllusminister plenipotentiarycercidiphyllum japonicumchlorophyllum molybditeslycopodium alopecuroides
...View all with 23 letters...
Words (3)
hyperbetalipoproteinemiaphosphatidylethanolaminemicroelectrophoreticallyPhrases (44)
subphylum cephalochordataapocynum androsaemifoliumfederal republic of germanychrysosplenium americanumhaematoxylum campechianumposterior meningeal arteryperfectly inelastic demandfamily plasmodiophoraceaeprimary atypical pneumoniaaleksey maximovich peshkov
...View all with 24 letters...
Words (2)
immunoelectrophoreticallyphosphatidylethanolaminesPhrases (30)
myroxylon balsamum pereiraesymphoricarpos orbiculatuspolystichum acrostichoidesmelanerpes erythrocephaluscaulophyllum thalictroidestrans-alaska pipeline systemmichelson-morley experimentlepidocybium flavobrunneumtympanuchus pallidicinctushormone-replacement therapy
...View all with 25 letters...
Phrases (28)
employee stock ownership planbureau of diplomatic securityentandrophragma cylindricumsystemic lupus erythematosuscalycophyllum candidissimumscardinius erythrophthalmusintermediate temporal arteryclosed-end investment companymononuclear phagocyte systembasal body temperature method
...View all with 26 letters...
Phrases (18)
holy roman emperor frederick iiaugustus welby northmore puginpull the wool over someone's eyesthyrotropin-releasing hormoneprimary sexual characteristichypothalamic releasing factorlymphocytic choriomeningitisamyotrophic lateral sclerosispleomorphic rhabdomyosarcomalimb-girdle muscular dystrophy
...View all with 27 letters...
Phrases (15)
cardiopulmonary resuscitationdepartment of homeland securitydissident irish republican armyrevolutionary proletarian armysmall computer system interfacesingle nucleotide polymorphismimperial japanese morning gloryhypothalamic releasing hormoneeucalyptus maculata citriodorafamilial hypercholesterolemia
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (13)
international olympic committeemiddle east respiratory syndromehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisontheory of punctuated equilibriumanonymous file transfer protocolpressure-feed lubricating systemcypripedium calceolus pubescensenvironmental protection agency
...View all with 29 letters...
Phrases (11)
obsessive-compulsive personalitydepartment of energy intelligencebalance of international paymentspolymonium caeruleum van-bruntiaehyperbilirubinemia of the newbornmucocutaneous lymph node syndromehenri rene albert guy de maupassantpositional representation systemprovisional irish republican armybasic point defense missile system
...View all with 30 letters...
Phrases (1)
socialist people's libyan arab jamahiriyaPhrases (1)
minnesota multiphasic personality inventory
