Words Containing: L,Y,G,I
(In Any Order)
There are 3,889 words,
1,720 phrases and
0 abbr's with
L,Y,G,I in.
Best Scoring Words With: L,Y,G,I
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
grizzly | 7 | 29 | noun, adjectiven, adj | |||||
noun • powerful brownish-yellow bear of the uplands of western North America adjective satellite • showing characteristics of age, especially having grey or white hair | ||||||||
gauzily | 7 | 20 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
glazily | 7 | 20 | ||||||
Valid word for Scrabble US
| ||||||||
lazying | 7 | 20 | verbv | |||||
Valid word for Scrabble US
| ||||||||
glitzy | 6 | 19 | adjectiveadj | |||||
adjective • Brilliantly showy. | ||||||||
jiggly | 6 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
gawkily | 7 | 18 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
glyphic | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
flighty | 7 | 17 | adjectiveadj | |||||
adjective satellite • guided by whim and fancy • unpredictably excitable (especially of horses) | ||||||||
jingly | 6 | 17 | adverb, adjectiveadv, adj | |||||
adjective satellite • having a series of high-pitched ringing sounds like many small bells | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (119)
playingyellingbiologylightlytightlygrizzlyrightlyrelyingcyclingnightlyyelpingstylingglorifyslayingangrilytrilogyagilityflightyliturgygiddilyrigidlyblightycloyinglevyinggristlybelyingglycineignoblygustilywrigglylegiblysightlyagilelymyalgiagaudily
...View all with 7 letters...
Phrases (2)
fly highglide byWords (235)
slightlyalmightydaylightapplyingbullyingideologyimplyinglovinglybrightlyskylightlobbyingyodelingrallyingyieldinglynchinglegalityjokinglyoutlyingsquigglydallyingplaygirlrelayingmightilybelayingallayinggingerlyglyceringreedilygraylingtallyinglayeringungainlyglitterybenignlysullying
...View all with 8 letters...
Phrases (3)
egg yieldlaying onsego lilyWords (456)
yggdrasilillegallyamazinglywillinglygenuinelyseeminglyrecyclinganalyzingmagicallysmilinglylogicallysupplyingsociologyknowinglylongevitydaylightsplaythinganalysingvulgarityradiologydigitallyunsightlyoligarchyfragilitysyllogismmockinglyglycerinevaryinglyglaringlypygmalionsprightlygentilitycunninglysparinglywinningly
...View all with 9 letters...
Phrases (23)
high styleloya jirgaegg layingivy leaguenot guiltyyoung girlflying foxholy grailglory lilygolgi body
...View all with 9 letters...
Words (616)
originallytragicallyyugoslaviaunderlyingrightfullyphysiologyvigorouslyobligatoryqualifyinggraciouslynegativelysurgicallyplaywrighttoxicologydiligentlyshockinglylegitimacyneighborlyscathinglystunninglygrievouslygloriouslyunyieldingcharminglyrigorouslyregularitycardiologyclarifyingdiagonallyswimminglysingularlyfalsifyingannoyinglystrikinglylaryngitis
...View all with 10 letters...
Phrases (39)
dry wallinggrey willowhanging flyivy leaguerleydig celllady godivaglycine maxglyptic artray of lightflying boat
...View all with 10 letters...
Words (577)
geneticallyaccordinglycalligraphyexceedinglyunwittinglyunknowinglyoriginalityterminologysingularityreligiouslymultiplyingichthyologyfrightfullyunwillinglycriminologyeligibilityorganicallysymbolizinglingonberryscientologygullibilityyugoslavianappallinglyplaywritingangelicallycryobiologystultifyingsimplifyingornithologygeophysicalgraphicallylingeringlymalignantlythrillinglyindignantly
...View all with 11 letters...
Phrases (64)
grass familylaying claimhigh qualitylaying wastebulb syringesingle entryplaying areadry cleaningrunning playbilly graham
...View all with 11 letters...
Words (541)
psychologistincreasinglysurprisinglygynecologistaggressivelystorytellingmythologicalbiologicallyfigurativelytriglyceridedelightfullyconvincinglydisgustinglylegitimatelyelectrifyinghieroglyphicrefreshinglybodybuildingunimaginablydisturbinglyegyptologistcongenialityecologicallyterrifyinglycompellinglybelligerencyphylogeneticungraciouslybegrudginglyforthrightlyhypoglycemicmicrobiologyphysiologiststaggeringlyirregularity
...View all with 12 letters...
Phrases (87)
genus glycineshaking palsydwight l. moodypolicy changefolding moneyginkgo familygravity faultlong-fin tunnybridge playervirility drug
...View all with 12 letters...
Words (446)
psychologicalsignificantlyinterestinglyprogressivelyhieroglyphicsphysiologicalgynaecologiststrategicallycategoricallyintelligentlyfrighteninglymagnificentlyastonishinglynitroglycerineverlastinglyideologicallypainstakinglyoveranalyzingbiotechnologygrammaticallyhypoglycaemicinfuriatinglydistressinglyenergeticallygynecologicalunflinchinglyunremittinglydisparaginglyhumiliatinglyhyperglycemicendocrinologyichthyologistunrelentinglymeaninglesslytypographical
...View all with 13 letters...
Phrases (96)
vaginal arterygilbert murraydwindling awaysalivary glandgenus dactylislillie langtryrose globe lilycatalog buyinghenry fieldingnylon stocking
...View all with 13 letters...
Words (319)
overwhelminglygeographicallypathologicallynitroglycerineexcruciatinglygynaecologicalembarrassinglylinguisticallysociologicallyunintelligiblyunconvincinglyentertaininglydemythologisedbiographicallydiagnosticallyastrologicallyunsuspectinglyanesthesiologysuggestibilityetymologicallydisapprovinglyunhesitatinglyethnologicallyoverpoweringlymagniloquentlyillegitimatelyimpregnabilitydemythologizeddisingenuouslydepolymerizingthyroglobulinsgenerationallylightheartedlyinfrangibilitygeohydrologist
...View all with 14 letters...
Phrases (140)
pituitary glandhigh technologyveliky novgoroddizzy gillespieprogram libraryright to libertykyrgyz republictightly fittingrudyard kiplingmagnolia family
...View all with 14 letters...
Words (247)
psychologicallytechnologicallyanaesthesiologyphysiologicallychronologicallysynergisticallyoversimplifyingpsychobiologistcondescendinglydisappointinglyneurophysiologycytomegalovirusrecrystallizingdramaturgicallylogarithmicallygastronomicallyunquestioninglyseismologicallycorrespondinglydemographicallyheartbreakinglyinterrogativelyaccommodatinglyagranulocytosisunchangeabilitysidesplittinglycommiseratinglyalgorithmicallyphysiographicalpsychoanalyzingmarriageabilityunintelligentlydisenchantinglyretrogressivelynonbelligerency
...View all with 15 letters...
Phrases (151)
syringa vulgarisbenefit of clergyasamiya languagemail-order buyinggenus sylvilagusgenus bombycillafamily triglidaedoris may lessingegg-laying mammalmarginal utility
...View all with 15 letters...
Words (106)
hyperintelligentphylogeneticallyuncompromisinglypsychophysiologyunapologeticallypsychobiologicalphotographicallyparapsychologistinextinguishablyparadigmaticallypornographicallyparamagneticallyradiographicallytrinitroglycerinotolaryngologisthyperstimulatingparapsychologiesdimethylglyoximehyperventilatingphotolithographynonpsychologicalarchaeologicallypathophysiologichemoglobinopathycriminologicallyorganizationallyichthyologicallyiconographicallycryptozoologistslyginopteridalesstenographicallycrystallographiclithographicallyflabbergastinglynonsignificantly
...View all with 16 letters...
Phrases (161)
italian greyhoundstrictly speakingcapital of hungarycardiac glycosidecommercial agencyalan lloyd hodgkindwight lyman moodycalystegia sepiumisland of guernseypharyngeal tonsil
...View all with 16 letters...
Words (73)
straightforwardlybacteriologicallyanthropologicallyneurophysiologistpsycholinguisticsradiobiologicallyunexchangeabilityparapsychologistsparasitologicallypathophysiologiesferrimagneticallymorphogeneticallylexicographicallycrystallographiesmicropaleontologylymphangiographiccytomegalovirusesconfigurationallycytotechnologistspharmacologicallyimmunogeneticallyelectronegativitystrongyloidosisesoceanographicallybibliographicallyzoogeographicallyglycosaminoglycantrigonometricallyhyperintelligenceunintelligibilitychromolithographyotolaryngologicalneurophysiologiesotolaryngologistsdisadvantageously
...View all with 17 letters...
Phrases (160)
hypoglycemic agentpearly everlastingmalaysian languagetheological systemcylindrical liningrepublic of hungarytypha angustifoliayeniseian languagefamily engraulidaemimus polyglotktos
...View all with 17 letters...
Words (45)
hypercoagulabilitypsychopathologicalinterchangeabilitysociopsychologicalneuropsychologicalspectroheliographypathophysiologicallaryngopharyngitislymphangiographiesautobiographicallydistinguishabilitymagnetostrictivelyphenomenologicallyophthalmologicallygeochronologicallyneuroendocrinologyglycosaminoglycansoscillographicallygranulocytopoiesesspectrographicallygranulocytopoiesisneurophysiologistselectromyographiesultracentrifugallyneuropsychologistsmetallographicallydemythologizationselectrophysiologicpropagandisticallyrhinolaryngologistroentgenologicallyhistophysiologicalhydrometallurgicalpsychobiographicalsedimentologically
...View all with 18 letters...
Phrases (156)
bombycilla garrulusrevolutionary groupfreudian psychologynavigational systemfamily asparagaceaefamily polygalaceaefulminating mercuryfamily magnoliaceaegene delivery vectorarthur garfield hays
...View all with 18 letters...
Words (27)
psychophysiologicalcinematographicallyextralinguisticallyotorhinolaryngologyparthenogeneticallycrosslinguisticallychromatographicallydehydrochlorinatingelectromagneticallyhysterosalpingogramcross-linguisticallyelectrophysiologieselectrophysiologistelectroretinographycharacterologicallyhistopathologicallyhistoriographicallyhydrometeorologicalhydrometeorologistspsychopharmacologicsymptomatologicallyphytogeographicallyphytohemagglutininssociolinguisticallypsychophysiologistspaleogeographicallyelectrocardiographyPhrases (128)
building supply housejohn millington syngefamily cynoglossidaealpine type of glaciergiles lytton stracheycapital of kyrgyzstansalicylate poisoninghydrobates pelagicussolidarity surchargefamily zingiberaceae
...View all with 19 letters...
Words (16)
polyphiloprogenitivecrystallographicallyindistinguishabilitylymphogranulomatosismagnetofluiddynamicsoophorosalpingectomyneurophysiologicallyelectrophysiologicalelectrophysiologistsroentgenographicallypsychopathologicallypsychopharmacologiespsychopharmacologistsyncategorematicallyhypercoagulabilitiesplethysmographicallyPhrases (98)
oryctolagus cuniculusclyde william tombaughbyelorussian languagemagnetic bubble memoryclassifying adjectiveluscinia megarhynchosfamily gasterosteidaemilitary intelligenceglycerol tripalmitatefamily gleicheniaceae
...View all with 20 letters...
Words (11)
psychopharmacologicalhypogammaglobulinemiaotorhinolaryngologistotorhinolaryngologieselectromyographicallydendrochronologicallyphotolithographicallyantiferromagneticallypsychopharmacologistspsychophysiologicallyclinicopathologicallyPhrases (91)
bulgarian monetary unitcynoglossum officinaleginglymostoma cirratumsamuel taylor coleridgeagricultural chemistryfamily myrmecophagidaespeech intelligibilityhans holbein the youngerfamily grossulariaceaecongenital abnormality
...View all with 21 letters...
Words (3)
otorhinolaryngologicalotorhinolaryngologistselectrophysiologicallyPhrases (75)
high-density lipoproteinguatemalan monetary unitamygdalus communis amaraguided missile destroyerhenry engelhard steinwaysamuel pierpoint langleydisplaying incompetencenotemigonus crysoleucasedward kennedy ellingtonbahasa malaysia language
...View all with 22 letters...
Words (2)
laryngotracheobronchitiselectrocardiographicallyPhrases (39)
carnegie mellon universitymary wollstonecraft godwinunidentified flying objectzollinger-ellison syndromedistinguished flying crosstechnology administrationfederal republic of germanypaul johann ludwig von heyseposterior meningeal arteryconstitutional psychology
...View all with 24 letters...
Phrases (20)
francis scott key fitzgeraldcentral intelligence agencyedmund john millington syngereligious society of friendssir arthur stanley eddingtonreticular activating systemarab revolutionary brigadescygnus columbianus bewickiimargaret munnerlyn mitchellmercury-in-glass thermometer
...View all with 25 letters...
Phrases (20)
brassica oleracea gongylodessubmandibular salivary glandevelyn arthur saint john waughassyrian neo-aramaic languageentandrophragma cylindricumbenign prostatic hyperplasiamyrtillocactus geometrizansgilles de la tourette syndromecircumflex artery of the thighcalifornia single-leaf pinyon
...View all with 26 letters...
Words (1)
electroencephalographicallyPhrases (22)
george percy aldridge graingeraleksandr sergeyevich pushkinaugustus welby northmore puginco-operative republic of guyananuclear regulatory commissiontricyclic antidepressant drugjames augustine aloysius joycethyrotropin-releasing hormonecryptobranchus alleganiensistopical prostaglandin eyedrop
...View all with 27 letters...
Phrases (14)
revolutionary people's struggleephippiorhynchus senegalensisrevolutionary communist leaguecygnus columbianus columbianussingle nucleotide polymorphismimperial japanese morning gloryhypothalamic releasing hormonecentral intelligence machinerymilitary intelligence section 5military intelligence section 6
...View all with 28 letters...
Phrases (12)
great smoky mountains national parkdigital communications technologydiego rodriguez de silva y velazquezprimary subtractive color for lightrichard august carl emil erlenmeyerinternational atomic energy agencyinternational intelligence agencymarine corps intelligence activityovulation method of family planninghuygens' principle of superposition
...View all with 31 letters...
Phrases (9)
weakly interacting massive particlesergei aleksandrovich koussevitzkyrevolutionary justice organizationnonsteroidal anti-inflammatory drugprimary subtractive colour for lightlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkoattorney general of the united statescystic fibrosis transport regulatorPhrases (9)
pityrogramma calomelanos aureoflavaright to speedy and public trial by jurykonstantin sergeyevich stanislavskymercury-in-glass clinical thermometerfloating-point representation systemhighly active antiretroviral therapyinternational law enforcement agencyunited states intelligence communityphysiological jaundice of the newbornPhrases (1)
enzyme-linked-immunosorbent serologic assay