Words Containing: L,S,K,Y
(In Any Order)
There are 430 words,
381 phrases and
0 abbr's with
L,S,K,Y in.
Best Scoring Words With: L,S,K,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
skywalk | 7 | 21 | nounn | |||||
noun • an elevated walkway between buildings (usually enclosed) | ||||||||
shylock | 7 | 19 | nounn | |||||
noun • a merciless usurer in a play by Shakespeare • someone who lends money at excessive rates of interest | ||||||||
bashlyk | 7 | 19 | nounn | |||||
Valid word for Scrabble US
| ||||||||
shlocky | 7 | 19 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
skylark | 7 | 18 | verb, nounv, n | |||||
noun • brown-speckled European lark noted for singing while hovering at a great height verb • play boisterously | ||||||||
kylikes | 7 | 18 | nounn | |||||
noun • An Ancient Greek drinking cup with a stem, two handles, and a broad, shallow body | ||||||||
skylike | 7 | 18 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
shakily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in an insecurely shaky manner • in a manner characterized by trembling or shaking | ||||||||
huskily | 7 | 17 | adverb, adjectiveadv, adj | |||||
adverb • in a hoarse or husky voice | ||||||||
valkyrs | 7 | 17 | nounn | |||||
Valid word for Scrabble US
| ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (44)
shylocksparklyskylineskylarkshakilybrisklysoymilkskywalkstarklykeylessslicklyslacklylackeyskylikesskylikesleeklysulkilysnakilysilkilyalkynespeskilyspikilybeyliksskysailkeypalsduskilyriskilygalyaksmuskilybytalkshuskilybashlykvalkyrsshlockysmokily
...View all with 7 letters...
Phrases (2)
yolk sacsky glowWords (68)
skylightklystronflyspeckshockleysneakilyrakishlyspookilykolinskyskimpilyfolkwaysslinkilyswankilykilljoysflunkeysskylineswalkwaysjaywalksyamalkasyokelessfriskilylinkboysschlockysmirkilystockilylekythussnarkilykeyholesfolksilykielbasyshylocksstalkilyskylarksskysailskissablyyokelish
...View all with 8 letters...
Phrases (6)
yak's milkstink flysilky elmsilky oaksoya milksky pilotWords (78)
skilfullyankylosismawkishlyknavishlysylphlikepuckishlysyruplikeskylarkerirksomelywalkyrieshawkishlygawkishlyankylosedberserklyyarmelkesyarmulkeskaleyardsplaybooksweakishlylatchkeyssketchilystreakilymalarkeysblackboysflyspecksplastickyklystronsshylockedkilobytesmonkishlywalkawaysskylarkedflunkyismskylightsyeastlike
...View all with 9 letters...
Phrases (4)
lake nyasalyre snakelady's leeksky burialWords (78)
mistakenlyrecklesslyshockinglyskillfullyfreakishlystrikinglyspankinglyunshakablyankylosaurtrickishlyprankishlycocksurelyskylarkersskylightedsneakinglyskeletallyskittishlystylebooksbuckyballsplaymakershyperlinkshollyhocksleukocytesflyspeckedshylockingticklishlykilocyclessemiweeklyfecklesslyskylarkingflunkyismsmollymawksjaywalkersankylosingnewsweekly
...View all with 10 letters...
Phrases (16)
isle of skyefloppy disksafety lockplay tricksalkyd resinkeyhole sawstroke playlady's smockroy wilkinskrebs cycle
...View all with 10 letters...
Words (56)
honeysuckleunspeakablyskulduggerykinesiologysickeninglyskepticallytiddlywinksoutspokenlyflyspeckingyokefellowsbricklayersalkylationsplaymakingslymphokinesbrainsicklylickerishlyankylosaurstracklayerskaryologieskaryolymphskittenishlythanklesslychelyabinskskuldudderyunskilfullysnakeblennyself-mockeryflunkeydomsflunkeyismsskylarkingsjaywalkingsyellowbacksshriekinglyyellowbarksyellowcakes
...View all with 11 letters...
Phrases (18)
louis leakeyglossy snakemackerel skyclosely knitcelery stickstock symbolleon trotskysystem clockskeleton keyloosely knit
...View all with 11 letters...
Words (39)
skullduggeryunmistakablystanislavskyankylosaurushoneysucklesunskillfullybricklayingscytoskeletonleukocytosiscytoskeletalleukocytoseshypokalemiastracklayingskeratoplastygallygaskinspinnywinkleshoneysuckledblackish-grayblackish-greycockyleekiesgreyish-blacktiddleywinkspennywinklesalkalescencyladylikenessfernyticklesgrayish-blacksparkleberrydusky-coloredpoikilocyteskaryologistskaryoplasmicpancake-stylelocksmitherycycloalkanes
...View all with 12 letters...
Phrases (14)
lickety splitshaking palsyalfred kinseyturk's cap-lilyslippery dickall-day suckerrayleigh diskrusty gracklesalt lake cityskittle alley
...View all with 12 letters...
Words (13)
painstakinglyholidaymakerscytoskeletonsgobbledygookstiddledywinksunshrinkinglyfairnyticklesklyuchevskayacryoplanktonsunmistakeablyankyloglossiadusky-colouredsketchabilityPhrases (27)
el iskandriyahnylon stockingwhiskey bottlesilky wisteriaryukyu islandsmollusk familyyellowish pinksnake polypodyblended whiskylaundry basket
...View all with 13 letters...
Words (11)
leukodystrophyphytoplanktersankylosaurusesearthshakinglycantankerouslyphytoplanktonsleukocytosisesblackberryingsvelvety-skinnedyekaterinoslavladylikenessesPhrases (29)
blackberry bushskeletal systemblended whiskeyemily dickinsonbishop berkeleysleepy sicknessblack raspberryostyak languagestanley kubrickrockrose family
...View all with 14 letters...
Words (8)
lackadaisicallykinestheticallyankylostomiasesankylostomiasischolecystokininlymphoblast-likehuckleberryingsdiphenylketonesPhrases (22)
erlenmeyer flaskalfred korzybskisecurity blanketwilliam shockleygenus myxinikelahydraulic brakesmarya sklodowskaswamp blackberrysprinkler systemstinking gladwyn
...View all with 15 letters...
Words (5)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricscholecystokininsPhrases (33)
strictly speakinghypophyseal stalkcock-and-bull storyelwyn brooks whitetrackless trolleycoral honeysucklecomstock mealybugrodya raskolnikovwassily kandinskiwassily kandinsky
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (22)
nikolai rimsky-korsakovaleksandr solzhenitsynsri lankan monetary unitisle royal national parkthomas kennerly wolfe jr.schlumbergera buckleyimusculoskeletal systemthin-leaved stringybarkpeter ilich tchaikovskylymphoblastic leukemia
...View all with 21 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay