Words Containing: L,L,Y,K,A
(In Any Order)
There are 114 words,
197 phrases and
0 abbr's with
L,L,Y,K,A in.
Best Scoring Words With: L,L,Y,K,A
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
blackly | 7 | 18 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
flakily | 7 | 17 | adjectiveadj | |||||
Valid word for Scrabble US
| ||||||||
blankly | 7 | 16 | adverbadv | |||||
adverb • in a blank and uncomprehending manner | ||||||||
slackly | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • in a relaxed manner; not rigid | ||||||||
bleakly | 7 | 16 | adverb, adjectiveadv, adj | |||||
adverb • without hope | ||||||||
alkylic | 7 | 16 | adjectiveadj | |||||
adjective • of or related to an alkyl | ||||||||
balkily | 7 | 16 | ||||||
Valid word for Scrabble US
| ||||||||
leakily | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
lankily | 7 | 14 | adverb, adjectiveadv, adj | |||||
Valid word for Scrabble US
| ||||||||
alkyls | 6 | 13 | nounn | |||||
noun • any of a series of univalent groups of the general formula CnH2n+1 derived from aliphatic hydrocarbons | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
alkylWords (23)
thankfullyrockabillylawyerlikelikabilityunladylikealkalinitylukewarmlyskeletallyalkylatingbuckyballsmollymawksclankinglyalkylationyellowcakepickadillyblackishlymollyhawksyellowbackyellowbarkwalky-talkycockabullywoollybackkallitypesPhrases (9)
alkyl grouplady killergrace kellytally clerka. e. kennellyyellow jackblack sallyblue sky lawlake baykalWords (20)
skepticallytalkativelyalkylationsalkalimetryalkalifyingkineticallythanklesslyyellowbacksyellowbarksyellowcakestracklesslytalkabilitypilgarlickysparklesslycycloalkenesparklinglysilky-leafedsilky-leavedcycloalkanewoollybacksPhrases (5)
louis leakeylike royaltyalkyl halidenickel alloyrock wallabyWords (11)
cytoskeletalblackguardlykaryologicalyellow-markedgallygaskinsknowledgablyalkylbenzenealkalescencyladylikenessunthankfullycycloalkanesPhrases (11)
alkyl radicalalben barkleyyellow jacketturk's cap-lilyall-day suckerpayroll checksalt lake citykarol wojtylaskittle alleyblack salsify
...View all with 12 letters...
Words (7)
lackadaisicallykinestheticallytelekineticallyknowledgabilitykenogeneticallyacknowledgeablylymphoblast-likePhrases (14)
erlenmeyer flaskwilliam mckinleymarketable yieldwilliam shockleyfield hockey ballocellated turkeyarthur e. kennellyalkylating agentnickel-base alloyblack elderberry
...View all with 15 letters...
Words (1)
alkylbenzenesulfonatePhrases (12)
aleksandr solzhenitsynisle royal national parkthomas kennerly wolfe jr.schlumbergera buckleyimusculoskeletal systemlymphoblastic leukemiaharley granville-barkeraustralian honeysucklenew zealand honeysuckleankylosing spondylitis
...View all with 21 letters...
Phrases (1)
count lev nikolayevitch tolstoyPhrases (1)
technical analysis of stock trendsPhrases (1)
vladimir vladimirovich mayakovskiPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
enzyme-linked-immunosorbent serologic assayPhrases (1)
international relations and security network