Words Containing: L,K,Y
(In Any Order)
There are 972 words,
747 phrases and
0 abbr's with
L,K,Y in.
Best Scoring Words With: L,K,Y
More words | ||||||||
---|---|---|---|---|---|---|---|---|
Expand? | Word | Save? | Length | Usage | Points | Type | ||
kolkozy | 7 | 27 | nounn | |||||
Valid word for Scrabble US
| ||||||||
kolhozy | 7 | 26 | nounn | |||||
Valid word for Scrabble US
| ||||||||
quickly | 7 | 25 | adverbadv | |||||
adverb • with speed • with little or no delay • without taking pains | ||||||||
jaywalk | 7 | 24 | verb, adverbv, adv | |||||
verb • cross the road at a red light | ||||||||
quakily | 7 | 23 | ||||||
Valid word for Scrabble US
| ||||||||
klutzy | 6 | 22 | adjectiveadj | |||||
adjective • Awkward, clumsy or socially inept | ||||||||
killjoy | 7 | 21 | nounn | |||||
noun • someone who spoils the pleasure of others | ||||||||
skywalk | 7 | 21 | nounn | |||||
noun • an elevated walkway between buildings (usually enclosed) | ||||||||
jerkily | 7 | 21 | adverb, adjectiveadv, adj | |||||
adverb • with spasms • with jerking motions | ||||||||
walkway | 7 | 20 | nounn | |||||
noun • a path set aside for walking | ||||||||
or scroll down to see all results... | ||||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (130)
quicklyfranklyluckilyunluckypricklybarkleyshylockwrinklysparklyskylinekeyholewalkwaykilljoyblanklyskylarkshakilythicklybrisklyflunkeycolickysoymilkskywalkbeckleynakedlystarklyjaywalkcracklyfrecklycrinklykeylessblacklytwinklyslicklymalarkywackily
...View all with 7 letters...
Phrases (8)
egg yolkdry kilndry milkkey limekey palmyolk saczyklon asky glowWords (165)
brooklynunlikelyberkeleyskylightplaybackmckinleyplaybookmalarkeykennellyladylikejokinglyyarmulkeunkindlyvalkyriewickedlyklystronflyspecklackadayyarmulkamarkedlylatchkeyshockleywalkawayknightlybiweeklysneakilygarlickykilobyterakishlyblanketyspookilykolinskycheekilytrickilyskimpily
...View all with 8 letters...
Phrases (24)
baby talklock awayeye blinkblack flymilk wheyplay backyak's milkholy weekkay boylestink fly
...View all with 8 letters...
Words (163)
knowinglyawkwardlymockinglydrunkenlyunluckilykimberleyjaywalkerplaymakerskilfullyleukocytejellylikebuckyballankylosisalackadaycuckoldryhollyhockhyperlinkmawkishlycrookedlypuppylikeknavishlybumpkinlysylphlikeberrylikepuckishlyquakinglywakefullyfairylikesyruplikeskylarkerirksomelywalkyrieshawkishlygawkishlyankylosed
...View all with 9 letters...
Phrases (23)
lake nyasalike crazyturkey legkeep relaycity blockmilk yieldangry walklayer cakemyrtle oakgene kelly
...View all with 9 letters...
Words (134)
remarkablythankfullyblackberrymistakenlybricklayerrecklesslyshockinglyskillfullyfreakishlystrikinglyrockabillylawyerlikespankinglyunshakablylikabilityunladylikealkalinityankylosaurlukewarmlyplaymakingtrickishlyprankishlycocksurelybackwardlyskylarkersskylightedsneakinglyyokefellowskeletallythinkinglyalkylatingskittishlykaryolymphstylebooksbuckyballs
...View all with 10 letters...
Phrases (48)
mary leakeymt. mckinleytalk turkeyalkyl groupisle of skyepink familylady killerpoyang lakefloppy diskgrace kelly
...View all with 10 letters...
Words (96)
unknowinglyhuckleberryhoneysuckleunspeakablyskulduggeryyellowknifehypokalemiahypokalemickinesiologybricklayingsickeninglyskepticallyworkabilitytiddlywinksunthinkablytalkativelyprovokinglyoutspokenlyhyperlinkedflyspeckingbankabilityyokefellowsbricklayersalkylationschucklinglychimneylikeplaymakingsalkalimetrylymphokinesbrainsicklyfactorylikelickerishlyalkalifyingankylosaurstracklayers
...View all with 11 letters...
Phrases (46)
louis leakeyglossy snakelike royaltybilly the kidpolicy makermackerel skyalkyl halideclosely knittightly knitemmett kelly
...View all with 11 letters...
Words (70)
skullduggerygobbledygookunmistakablystanislavskyhyperkalemiaunthinkinglyankylosaurusholidaymakerhyperlinkinghoneysucklesunskillfullyunblinkinglyflickeringlybricklayingscytoskeletonleukocytosiscytoskeletalunremarkablyleukocytosesblackguardlydaydreamlikekremlinologydrinkabilityhypokalemiastracklayingskaryologicalbackhandedlykeratoplastyyellow-markedgallygaskinspinnywinklesknowledgablyhoneysuckledyankee-doodlerevokability
...View all with 12 letters...
Phrases (57)
lickety splithockey clinicshaking palsyhockey leaguealkyl radicalginkgo familyalben barkleyblink of an eyealfred kinseyyellow jacket
...View all with 12 letters...
Words (36)
painstakinglymarketabilityphytoplanktonholidaymakerscytoskeletonsknowledgeablyunworkabilityphytoplanktergobbledygookstiddledywinksunknowabilitykindheartedlykinematicallyunshrinkinglythankworthilyhe-huckleberryblackberryingfairnyticklesclickety-clackclickety-clickblockheadedlyjawbreakinglyklyuchevskayacryoplanktonsremarkabilityheartbrokenlyunmistakeablyankyloglossiadusky-colouredhydraulickingpoikilothermysketchabilitykatabolicallyforeknowinglyprickly-leafed
...View all with 13 letters...
Phrases (56)
el iskandriyahyakut languagemount mckinleyjekyll and hydecocktail partynylon stockingnorfolk wherryrichard leakeyblack mulberrywhiskey bottle
...View all with 13 letters...
Words (19)
unthinkabilityleukodystrophyphytoplanktersankylosauruseskaryotypicallybreathtakinglyearthshakinglycantankerouslyacknowledgedlyphytoplanktonshydrokineticalleukocytosisesblackberry-lilyblackberryingsvelvety-skinnedhuckleberryingyekaterinoslavladylikenessesdiphenylketonePhrases (73)
dimethyl ketonedrunken revelryveliky novgorodcapital of kenyablackberry bushskeletal systemblended whiskeyold world monkeyemily dickinsonkyrgyz republic
...View all with 14 letters...
Words (17)
lackadaisicallyheartbreakinglykinestheticallyankylostomiasesankylostomiasisphenylketonuriccholecystokinintelekineticallyphytoplanktonicphenylketonuriabrokenheartedlyknowledgabilitykenogeneticallyacknowledgeablylymphoblast-likehuckleberryingsdiphenylketonesPhrases (53)
erlenmeyer flaskbuckthorn familycapital of turkeydocking facilityalfred korzybskinetwork topologysecurity blanketwilliam mckinleymarketable yieldwilliam shockley
...View all with 15 letters...
Words (6)
leukodystrophieskinaestheticallyphenylketonuriasphenylketonuricscholecystokininsknowledgeabilityPhrases (57)
strictly speakinghypophyseal stalkalan lloyd hodgkincock-and-bull storycapital of new yorkfriendly takeoverfrank lloyd wrightfamily gekkonidaeelwyn brooks whitetrackless trolley
...View all with 16 letters...
Words (1)
alkylbenzenesulfonatePhrases (31)
nikolai rimsky-korsakovaleksandr solzhenitsynsri lankan monetary unitisle royal national parkjohn fitzgerald kennedythomas kennerly wolfe jr.schlumbergera buckleyimusculoskeletal systemthin-leaved stringybarkketamine hydrochloride
...View all with 21 letters...
Phrases (12)
francis scott key fitzgeraldtrans-alaska pipeline systempyotr alexeyevich kropotkinmelville louis kossuth deweycygnus columbianus bewickiialeksey maksimovich peshkovmikhail yurievich lermontovchronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russell
...View all with 25 letters...
Phrases (10)
holy roman emperor frederick iialeksandr sergeyevich pushkinfalkland islands monetary unitnikolai ivanovich lobachevskymikhail sergeyevich gorbachevuniversity of nebraska-lincolnkennedy international airporteysenck personality inventorymartin luther king jr's birthdaykepler's law of planetary motionPhrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
jakob ludwig felix mendelssohn-bartholdyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay